|
||
© The Rockefeller University Press,
0021-9525/2000//1263 $5.00
The Journal of Cell Biology, Volume 149, Number 6,
, 2000 1263-1274
Original Article |
The Nonreceptor Tyrosine Kinase Fer Mediates Cross-Talk between N-Cadherin and β1-Integrins
jlilien{at}biology.biosci.wayne.edu
Cadherins and integrins must function in a coordinated manner to effectively mediate the cellular interactions essential for development. We hypothesized that exchange of proteins associated with their cytoplasmic domains may play a role in coordinating function. To test this idea, we used Trojan peptides to introduce into cells and tissues peptide sequences designed to compete for the interaction of specific effectors with the cytoplasmic domain of N-cadherin, and assayed their effect on cadherin- and integrin-mediated adhesion and neurite outgrowth. We show that a peptide mimicking the juxtamembrane (JMP) region of the cytoplasmic domain of N-cadherin results in inhibition of N-cadherin and β1-integrin function. The effect of JMP on β1-integrin function depends on the expression of N-cadherin and is independent of transcription or translation. Treatment of cells with JMP results in the release of the nonreceptor tyrosine kinase Fer from the cadherin complex and its accumulation in the integrin complex. A peptide that mimics the first coiled-coil domain of Fer prevents Fer accumulation in the integrin complex and reverses the inhibitory effect of JMP. These findings suggest a new mechanism through which N-cadherin and β1-integrins are coordinately regulated: loss of an effector from the cytoplasmic domain of N-cadherin and gain of that effector by the β1-integrin complex.
Key Words: cadherin integrin Trojan peptides adhesion neurite outgrowth
© 2000 The Rockefeller University Press
| Introduction |
|---|
|
|
|---|
- and β- or
-catenin (Aberle et al. 1996; Wheelock et al. 1996). Other potential regulatory molecules are associated either directly or indirectly with the cytoplasmic domain: p120ctn (Reynolds et al. 1994; Ohkubo and Ozawa 1999; Thoreson et al. 2000); the nonreceptor protein tyrosine kinase Fer (Kim and Wong 1995; Rosato et al. 1998); Shc (Xu et al. 1997; Xu and Carpenter 1999); and the nonreceptor tyrosine phosphatase PTP1B (Balsamo et al. 1996, Balsamo et al. 1998). Integrins function as heterodimers, mediating adhesion between cells and the extracellular matrix (Hynes 1992; Cheresh 1993). Integrin function also depends on association with the actin-containing cytoskeleton, forming well defined focal adhesion complexes at points where actin fibers are anchored (Critchley et al. 1999). The activity of integrins and their association with actin is mediated and regulated by an extensive set of structural and regulatory proteins associated directly or indirectly with the cytoplasmic domain of the β1 subunit (Aplin et al. 1998; Hemler 1998; Schoenwaelder and Burridge 1999). It is apparent that the activity of these two receptor systems, and possibly many others, must be coordinated in time and space for the proper development of tissue architecture, and many of the regulatory proteins associated with the cytoplasmic domain of these two adhesion receptors are candidate cross-regulatory molecules. Although there is a growing body of literature documenting coordinate regulation between cadherin- and integrin-mediated adhesion systems, little is known about the levels or mechanisms through which such coordination takes place (Hodivala and Watt 1994; Finnemann et al. 1995; Monier-Gavelle and Duband, 1995, Monier-Gavelle and Duband 1997; Zu et al., 1996; Huttenlocher et al. 1998; Lu et al. 1998; Wu et al. 1998).
We speculated that coordinate regulation of cadherin and integrin function during development might be effected by the exchange of regulatory molecules associated with the cytoplasmic domain of these receptors. Thus, we sought to create reagents that have the potential to interfere specifically with the binding of such effectors to the cytoplasmic domain of cadherin. Two regions of the cytoplasmic domain of cadherin have been shown to be functionally important: a juxtamembrane region that acts as a dominant negative, blocking cadherin function when introduced into Xenopus blastomeres (Kintner 1992) or eye primordia (Riehl et al. 1996); and the β-catenin–binding region, which has been defined by cadherin deletions that result in the loss of β-catenin binding (Nagafuchi and Takeichi 1989; Stappert and Kemler 1994; Jou et al. 1995). Here, we show that peptides mimicking these two regions of N-cadherin attached to a cell permeation sequence enter cells and disrupt adhesion and neurite outgrowth. The peptide mimicking the juxtamembrane region (JMP) causes inhibition of both cadherin and integrin function, whereas the peptide mimicking the β-catenin–binding region causes inhibition of only cadherin function. We further show that inhibition of integrin function by JMP requires the presence of cadherin and the complex of proteins associated with its cytoplasmic domain. Finally, inhibition of integrin function is accompanied by a loss of the nonreceptor protein tyrosine kinase Fer from the cadherin complex of proteins and its concomitant appearance in the integrin complex of proteins, and blocking the association of Fer with the integrin complex reverses the effect of JMP on integrin function.
| Materials and Methods |
|---|
|
|
|---|
Other Materials
N-Cadherin, which was used as a substrate for neurite outgrowth, was purified from embryonic chick brains as described previously (Bixby and Zhang 1990; Balsamo et al. 1991). The laminin and fibronectin, which were used as substrates for neurite outgrowth or adhesion, were from GIBCO-BRL. For preparation of recombinant N-cadherin cytoplasmic domain and recombinant β-catenin, the cDNA sequence for the cytoplasmic domain of N-cadherin or the full-length cDNA for β-catenin were cloned into pGEX, expressed as glutathione-S-transferase fusion proteins, and purified on glutathione-4S-Sepharose columns (Pharmacia Biotech).
Preparation of Synthetic Peptides
The following peptides from the N-cadherin cytoplasmic domain and the nonreceptor tyrosine kinase Fer were synthesized as fusions with the antennapedia homeodomain cell permeation sequence (Derossi et al. 1994; Prochiantz 1996) and purified to >90% by HPLC (Genemed Biotechnologies, Inc.; see Fig. 1): control antennapedia peptide (COP), RQIKIWFQNRRMKWKK; catenin binding peptide (CBP), RQIKIWFQNRRMKWKKSLLVFDYEGSGSTAGSLSSL; juxtamembrane peptide (JMP), RQIKIWFQNRRMKWKKRQAKQLLIDPEDDVRDNILK; Shc binding region peptide (SBP), RQIKIWFQNRRMKWKKRRLDERPIHAEPQYPVRSAA; Fer coiled-coil domain peptide (FCC), RQIKIWFQNRRMKWKKEKYKEALAKGKETEKA; and Fer NH2-terminal peptide (FNT), RQIKIWFQNRRMKWKKKNSHEAVLKLQDWELR. All peptides were dissolved in sterile deionized water to a concentration of 10–30 mg/ml and stored in small aliquots at –80°C. Peptide activity was assessed in neurite outgrowth and adhesion assays din a range of 0.2–50 µM. Biotinylation of peptides was carried out using Sulfo-NHS-biotin according to the manufacturer's instructions (Pierce Chemical Co.).
|
0.09 mm2. Retina sections were resuspended in culture medium (F12 supplemented with 5 mM Hepes, pH 7.2, 0.6% glucose, 5 µg/ml insulin, 100 µg/ml transferrin, 5 ng/ml sodium selenite, and 5 mg/ml gentamycin) and plated on coverslips coated with the appropriate substrate. 2 h later, nonadherent sections were removed by washing. Single cells were prepared from chick retina as described previously (Balsamo et al. 1995). PC12 cells were cultured in DME supplemented with 5% FBS, 0.5% horse serum and antibiotics, and 100 µg/ml penicillin and streptomycin. L cells expressing N-cadherin (LN cells) were prepared by transfecting the full-length N-cadherin cDNA into L cells as previously described (Balsamo et al. 1998).
Neurite Outgrowth and Cell Adhesion Assays
Neural retina explants were cultured overnight in the presence of 2 µM peptides. Neurite outgrowth was visualized using phase optics. Neurite length was quantitatively assessed in sparse single cell cultures of E7 neural retina to prevent neurite fasciculation. Peptides were added 2 h after cell plating. After overnight culture, cells were fixed with 4% paraformaldehyde for 20 min at room temperature. The longest neurite per cell was measured using a Zeiss microscope equipped with a CCD camera attached to the Metamorph image analysis system (Universal Imaging Corp.). For each assay condition, the length of neurites from >100 cells bearing neurites longer than two cell diameters were categorized into three groups: 0–49, 50–99, and >100 µm.
Cell adhesion assays were carried out as described (Balsamo et al. 1996, Balsamo et al. 1998; Arregui et al. 1998). After a starvation period of 2 h for PC12 cells or overnight for L and LN cells, cells were resuspended by a brief treatment with 0.03% trypsin in HBSGK containing 1 mM Ca2+. Trypsin treatment was terminated by adding the trypsin inhibitor AESBF at 1 mM (Calbiochem). Cells in suspension were incubated for 2 h (retina cells, PC12 cells) or 6 h (L, LN cells) with peptides in DME-Hepes before plating onto the indicated substrates. For assays evaluating the effect of sequential addition of peptides, cells were incubated for 1 h with the first peptide (2 µM) before addition of the second (2 µM). Cell adhesion was evaluated after 45 min.
Substrates for neurite outgrowth and adhesion were prepared by coating glass coverslips (neurite outgrowth) or 96-well plates (adhesion) with poly-L-lysine for 2 h at room temperature, followed by the appropriate substrate (cadherin, 5 µg/ml; NCD-2, 50 µg/ml; laminin, 20 µg/ml; fibronectin, 20 µg/ml).
Peptide Penetration and Assays for Cytotoxicity
To assess peptide penetration into cells and tissue explants, biotinylated peptides were incubated with explants for 2, 4, and 16 h at a concentration of 2 µM. The explants were fixed, permeabilized with 0.5% Triton X-100 (for 10 min), and reacted with FITC-streptavidin. Fluorescent cells in different layers of the explant were examined using a confocal microscope.
To determine cytotoxicity, retina explants were incubated overnight in the presence of peptides (0.2, 2, 4, 10, and 50 µM). The medium was replaced by Hepes-buffered saline with added glucose and potassium (HBSGK: 20 mM Hepes, pH 7.2, 150 mM NaCl, 2 mM glucose, and 3 mM KCl) containing 1:500 dilution of the green fluorescent SYTO10 and the red fluorescent DEAD Red (Molecular Probes). After 15 min, explants were washed twice, fixed with paraformaldehyde, and observed using a fluorescence microscope. The fluorescence of SYTO10 and DEAD Red was analyzed using FITC and rhodamine filters, respectively.
Binding of Peptides to Recombinant Cadherin and β-Catenin
The antennapedia fusion peptides were biotinylated using sulfo-NHS-biotin (Pierce Chemical Co.). 4 µg of each peptide, or inactivated biotinylation reaction mix alone, were incubated overnight with 10 µg of recombinant cadherin cytoplasmic domain or β-catenin in 200 µl PBS, at 4°C. The reaction mixture was loaded into streptavidin-coated wells blocked with BSA. Protein bound to biotinylated peptide was detected using an antibody to the cytoplasmic domain of cadherin or a monoclonal anti–β-catenin antibody and the appropriate HRP-conjugated second antibody. Triplicate wells were measured for each peptide.
In Vitro Competition by CBP for Cadherin–β-Catenin Interaction
Neural retina homogenates were prepared in mild lysis buffer (MLB: 20 mM Tris, pH 7.4, 150 mM NaCl, 1% NP-40, 1 mM Na2VO4, 50 mM NaF, 1 mM AESBF, 10 µg/ml DNase, and 5 µg/ml each leupeptin, pepstatin, and aprotinin). The lysates were cleared by centrifugation at 14,000 g, and aliquots of the supernatant were incubated with increasing concentrations of JMP, CBP, or SBP for 2 h at 37°C with mixing. The lysates were immunoprecipitated with the anticadherin antibody NCD-2, the immunoprecipitates collected with anti-rat IgG conjugated to magnetic beads, fractionated by SDS-PAGE, transferred to polyvinylidene difluoride membranes, and probed with anti–β-catenin antibody and anticadherin antibody NCD-2. The density of the resulting bands was measured and the ratio of β-catenin to cadherin was determined.
Immunoprecipitation and Immunoblot Analysis
For analysis of the proteins associated with N-cadherin, cells were homogenized in MLB, the lysates were centrifuged at 14,000 g and the supernatants immunoprecipitated for 4 h at 4°C with the anti–N-cadherin antibody NCD-2. The NCD-2 immunoprecipitates were collected using goat anti–rat IgG conjugated to magnetic beads, and the supernatants were further immunoprecipitated with polyclonal anti–β-catenin antibody (Balsamo et al. 1995, Balsamo et al. 1998). Alternatively, to analyze protein associated with β1-integrin, cell lysates were immunoprecipitated with anti-FAK antibody. The immunoprecipitates were fractionated by SDS-PAGE and the Western transfers were probed with the indicated antibodies.
For analysis of tyrosine phosphorylation of p130cas, cells were lysed in RIPA buffer (10 mM Tris, pH 7.4, 150 mM NaCl, 1% NP-40, 0.1% SDS, 0.1% sodium deoxycholate, 50 mM NaF, 1 mM PMSF, 5 µg/ml leupeptin, and 1 mM Na2VO4), immunoprecipitated with anti-p130cas antibody, fractionated by SDS-PAGE, and Western transfers were probed with PY20.
| Results |
|---|
|
|
|---|
To establish that the antennapedia fusion peptides are indeed able to penetrate cells, we incubated E7 chick neural retina explants of
1 mm2 with each of the fusion peptides covalently linked to biotin. The explants were incubated with fluorescein-conjugated streptavidin and peptide penetration was assessed in confocal, planar images through the explant as well as cross-sectional reconstructions. All peptides penetrate equally well (Fig. 2 shows penetrance of CBP as an example). In addition, the antennapedia fusion peptides are not toxic to cells, as determined by assessing cell death using a SYTO/10 DEAD Red (Fig. 2, live cells are labeled green and dead cells are red). Very few cells are dead after 24 h of incubation of the explant either in the absence or presence of antennapedia peptides, and those that do appear dead are at the edge of the explant and may have been damaged during dissection and initial placement of the explant.
|
|
80% of neurites are between 50 and 99 µm in length (Fig. 4). In contrast, in the presence of JMP or CBP, only
20% of the neurites fall in this category (Fig. 4). When cells are plated on laminin, CBP has no discernible effect; however, treatment with JMP reduces the number of neurites in the >100 µm class to
10% (Fig. 4).
|
chains, in combination with β1-integrin, as receptors for laminin (see Fig. 8 D), indicating that the effect of JMP is specific for β1-integrin, independent of the attached
chain (Tomaselli et al. 1990; de Curtis and Reichardt 1993). Additionally, treatment of cells with cycloheximide or actinomycin D, to specifically inhibit protein or RNA synthesis, respectively, has no effect on the inhibition of cadherin or β1-integrin function by JMP (not shown). And finally, adhesion to poly-L-lysine, which does not involve cadherins or integrins, is unaffected by CBP or JMP (Fig. 5).
|
|
JMP and CBP Are Targeted to Specific Components of the Cadherin Adhesion Complex
CBP and JMP, but not control peptides, have specific effects on cadherin and integrin function, presumably based on their ability to compete for specific protein–protein interactions at the cytoplasmic domain of cadherin. To further demonstrate the specificity of these effects, we examined the interaction of the peptides with their putative targets. The CBP sequence corresponds to the binding site for β-catenin and, indeed, CBP binds directly to recombinant β-catenin (Fig. 6 A). In addition, CBP competes for up to 50% of the N-cadherin–bound β-catenin in cell lysates, as determined by immunoprecipitation with NCD-2 and immunodetection of β-catenin (Fig. 6 B). In contrast, JMP and SBP have little effect, even at concentrations as high as 12.5 µM (Fig. 6 B). On the other hand, JMP binds in vitro to the cytoplasmic domain of N-cadherin (Fig. 6 A), and biotin-labeled JMP localizes to areas of cell–cell contact, where cadherin is enriched (Fig. 6 C). This suggests that the juxtamembrane region of cadherin may participate in homodimer formation through a direct interaction, which is consistent with reports suggesting that the juxtamembrane domain of cadherin is indeed involved in cis-homodimerization (Ozawa and Kemler 1998; Yap et al. 1998).
|
-catenin, which in turn interacts with actin, either directly or through
-actinin (Wheelock et al. 1996). Binding of JMP does not alter the amount of β-catenin associated with N-cadherin (Fig. 7 A). On the other hand, CBP reduces the amount of β-catenin associated with cadherin (Fig. 7 A), as expected from results shown in Fig. 6. Thus, CBP uncouples cadherin from the cytoskeleton with a concomitant loss of function, probably through competition with the endogenous β-catenin binding site.
|
The Effect of JMP on Integrin Function Requires N-Cadherin and the Complex of Proteins Associated with the Cadherin Cytoplasmic Domain
A database search reveals no close similarity between the amino acid sequence of JMP and that of β1-integrin or any other integrin-associated peptide, suggesting that the effect of JMP on integrin function may occur through cadherin. To determine if this is indeed the case, we compared the effects of JMP on L cells, which express β1-integrins but not N-cadherin, and L-cells stably transfected with N-cadherin (Balsamo et al. 1998), which express both β1-integrins and N-cadherin. In this case, we used fibronectin as a substrate, since L cells adhere poorly to laminin. Both L cells and LN cells adhere equally well to fibronectin (see A585 values in Fig. 8A and Fig. B) and this adhesion is integrin-dependent, as >90% of attachment is inhibited by an arginine, glycine, aspartic acid–containing peptide (Arregui et al. 1998). However, similar concentrations of JMP inhibit LN cell adhesion to fibronectin but have little or no effect on L cell adhesion (Fig. 8A and Fig. B). CBP and control peptides have little or no effect on integrin-mediated adhesion of L-cells or LN-cells (Fig. 8A and Fig. B) but, as expected, CBP does inhibit cadherin-mediated adhesion of LN cells (Fig. 8 B). Thus, inhibition of integrin function by JMP requires the expression of cadherin. Furthermore, perturbation of the array of proteins associated with the cytoplasmic domain of cadherin by prior treatment with CBP, which causes the release of a complex of proteins containing β-catenin, p120ctn, and Fer, eliminates the effect of JMP on integrin-mediated adhesion. This is true for all three cell types tested: LN (not shown), E7 retina (Fig. 8 C), and PC12 (Fig. 8 D). Thus, JMP acts through N-cadherin to affect integrin function, and specific alterations in the cadherin complex induced by CBP abolish the effect of JMP on integrin function.
Inhibition of β1-Integrin Function by JMP Correlates with an Increase in Tyrosine Kinase Fer Associated with the Integrin Complex
Inhibition of integrin function depends on a specific configuration of effector molecules associated with the cytoplasmic domain of N-cadherin and is independent of protein and RNA synthesis. This suggests that one or more effectors, originally associated with the cytoplasmic domain of N-cadherin, may be released and directly affect integrin function. Of the proteins associated with the cytoplasmic domain of N-cadherin, only the tyrosine kinase Fer is specifically released on treatment of cells with JMP and is thus a candidate for cross-regulation. Therefore, we looked at the presence of Fer associated with the integrin complex. Neural retina cells were incubated with peptides, lysed in mild lysis buffer, and immunoprecipitated with anti-FAK antibody. After treatment with JMP, and concomitant with its release from the cadherin complex, there is an increase in Fer coimmunoprecipitated with FAK (Fig. 9 A) over control cells or cells treated with COP or CBP (Fig. 9 A). While Fer is also released from the cadherin cytoplasmic domain after treatment with CBP, it is in a complex with β-catenin and p120ctn and, thus, may be unable to translocate and/or bind to the integrin complex. In addition, we consistently see a decrease of 30–50% in the tyrosine phosphorylation of the integrin-associated adaptor protein p130cas after treatment of cells with JMP (Fig. 9 B). These data are in agreement with Rosato et al. 1998, correlating overexpression of Fer with inhibition of integrin function as well as hypophosphorylation of p130cas.
|
|
|
| Discussion |
|---|
|
|
|---|
This pathway is activated by the binding of the chondroitin sulfate proteoglycan neurocan to its receptor GalNAcPTase. This interaction results in the loss of cadherin and integrin function concomitant with the loss of Fer from the cadherin complex and its appearance in the integrin complex (Li et al. 2000). Neurocan is present in the developing central nervous system (Oohira et al. 1994; Meyer-Puttlitz et al. 1995; Fukuda et al. 1997; Matsui et al. 1998) and is prominent along axon tracts (Margolis et al. 1996). It is our working hypothesis that coordinate inactivation of cadherin and integrin at the edges of axon tracts is a major contributor to guidance.
What Is the Role of Fer in the Cadherin Complex?
We have previously reported that the presence of the nonreceptor protein tyrosine phosphatase PTP1B in the cadherin complex is essential for dephosphorylation of β-catenin and, therefore, N-cadherin function, and that binding of PTP1B to cadherin requires phosphorylation on tyrosine residues (Balsamo et al. 1996, Balsamo et al. 1998). We have also reported that hyperphosphorylation of β-catenin is not only correlated with the loss of PTP1B from the cadherin complex, but also with reduced tyrosine kinase activity associated with the cadherin complex (Balsamo et al. 1995). This loss of kinase activity from the cadherin complex may reflect the loss of Fer. Therefore, Fer may be required to phosphorylate PTP1B, targeting it to the cadherin complex. We are investigating this possibility. Additionally, overexpression of Fer has been shown to result in increased phosphorylation of p120ctn and β-catenin with concomitant dissolution of the cadherin–catenin complex, a state consistently correlated with loss of cadherin function (Daniel and Reynolds 1997; Lilien et al. 1997).
Fer may also play a role in cis-dimerization of cadherin through phosphorylation of p120ctn. cis-dimerization is required for strong adhesion (Brieher et al. 1996; Yap et al., 1997, Yap et al. 1998; Takeda et al. 1999) and the juxtamembrane region of cadherin has been implicated in regulation of cis-dimerization (Ozawa and Kemler 1998) and in binding of p120ctn (Thoreson et al. 2000). Ohkubo and Ozawa 1999 have reported that the presence of p120ctn interferes with homodimerization, whereas Thoreson et al. 2000 report that p120ctn is essential for the formation of strong adhesions. In fact, this apparent paradox may be a result of changes in the affinity of p120ctn for cadherin because of different states of p120ctn phosphorylation (Thoreson et al. 2000), possibly mediated by Fer. Indeed, increased phosphorylation on tyrosine residues has been reported to increase the affinity of p120ctn for cadherin (Roura et al. 1999). The direct binding of JMP to the cytoplasmic domain of N-cadherin suggests that this region mediates dimerization, whereas the immediate COOH-terminal sequences, through interaction with p120ctn, perform a regulatory function that may be modulated by Fer. The effect of JMP on N-cadherin–mediated neurite outgrowth and adhesion, thus, may be because of direct inhibition of dimerization, or indirectly a result of release of Fer and disruption of the phosphorylation of p120ctn. This suggests that Fer's role is in the formation and/or maintenance of cadherin dimers. In this same vein, Fer may be specifically recruited to cadherin dimers and any circumstances that inhibit dimerization might prevent binding of Fer, leaving it free to associate with integrin. However, this suggests a pool of free Fer, but this seems unlikely as integrin function would be continuously compromised. There is a pool of Fer associated with cortactin (Kim and Wong 1998) and it seems likely that Fer is sequestered by cortactin, p120ctn or other targets preventing its interaction with the β1-integrin complex.
If Fer is in fact bound to p120ctn as Kim and Wong 1995, Kim and Wong 1998 suggest, the ability of JMP to specifically effect its release suggests that interactions among the components associated with the cytoplasmic domain of cadherin are complex and interdependent. This complexity is also revealed by the effect of CBP. CBP competes for β-catenin binding, resulting in the release of a complex of proteins that includes p120ctn, β-catenin, and Fer. Indeed, a recent report (Huber et al. 1999) indicates that the cytoplasmic tail of E-cadherin folds upon binding of β-catenin, and that folding of the cytoplasmic tail may facilitate the binding of p120ctn. The converse may also hold; i.e., competition for β-catenin may cause the unfolding of the cytoplasmic tail affecting the binding of all components, resulting in their release as a complex. While these suggestions are speculative, they do raise interesting questions concerning interactions among the cadherin effectors and cadherin.
How Does Fer Affect Integrin Function?
The loss of integrin function on interaction of Fer is consistent with the loss of cell–substrate adhesion on overexpression of Fer (Rosato et al. 1998). Our observations and those of Rosato et al. 1998, that Fer-mediated loss of integrin function is correlated with a reduction in phosphorylation of p130cas are consistent with reports that phosphorylation of p130cas is correlated with assembly into focal adhesions (Nojima et al. 1995; Petch et al. 1995; Vuori and Ruoslahti 1995). p130cas is at the nexus of a subarray of effector molecules that regulate integrin function. It is an adaptor or docking protein with multiple interaction domains: an SH3 domain, multiple proline-rich regions, and critical tyrosine residues (Sakai et al. 1994). Both the tyrosine phosphatases PTP-PEST (Garton et al. 1997) and PTP1B (Liu et al. 1996), as well as the tyrosine kinase FAK (Polte and Hanks 1995) interact with p130cas through its SH3 domain, and it has been suggested that these components compete with each other to regulate the tyrosine phosphorylation of p130cas and, therefore, assembly of focal adhesions (Garton et al. 1997). Tyrosine phosphorylated p130cas also interacts with Crk through an SH2 domain (Matsuda and Kurata 1996). This interaction has two ramifications: it has the potential to protect p130cas from dephosphorylation (Birge et al. 1992) and appears to act through Rac to stimulate cell migration (Klemke et al. 1998). While the loss of focal adhesions correlates with the loss of tyrosine phosphorylation of p130cas, it is not clear how the presence of Fer in the integrin complex causes a reduction in p130cas phosphorylation. It is obvious that the effect of Fer is indirect; however, it is not clear through what partners Fer affects the dephosphorylation of p130cas. The simplest explanation is that phosphorylation of one of the p130cas' binding partners, PTP-PEST, PTP1B, FAK, or even Crk, alters their activity or their interaction with p130cas, changing the balance of phosphorylated tyrosine residues.
The Interaction of Fer with the Cadherin and Integrin Complexes
Fer has the potential to interact with multiple target sites. It has three coiled-coil domains (Craig et al. 1999), which have the potential to mediate multiple protein–protein interactions (Lupas 1996), and it has the potential to interact with SH2 or PTB (phosphotyrosine-binding) domains through phosphorylated tyrosine residues (Craig et al. 1999). Fer is presumed to interact directly with p120ctn (Kim and Wong 1995), and p120ctn has a predicted coiled-coil domain at its NH2 terminus (Reynolds et al. 1994), which has been suggested to interact with a coiled-coil domain of Fer (Kim and Wong 1995; Craig et al. 1999). We find that FCC has no effect on the association of Fer with the cadherin complex or on cadherin function; thus, if coiled-coil interactions do mediate the interaction, it is not through CC1. CC1 does appear to be involved in targeting to the integrin complex. However, it is not clear whether FCC blocks targeting through an effect on oligomerization of Fer itself (Craig et al. 1999) or through blocking formation of heteromultimers. These results suggest that targeting of Fer to the two complexes is mediated by distinct domains.
Our results demonstrate for the first time that specific regulatory alterations in a cadherin complex of proteins affect integrin function through an epigenetic mechanism: translocation of regulatory proteins from one adhesion receptor to another, or reequilibration and redistribution of a pool of effectors. The protein tyrosine kinase Fer, and possibly other effectors, may thus coordinately regulate cadherin and integrin function. This provides a mechanism for rapid, specific, and coordinate regulation of cell–cell and cell–substrate adhesion during development.
| Acknowledgments |
|---|
This study was supported by a grant from the National Institutes of Health (No. EY12132).
Submitted: 10 February 2000
Revised: 4 May 2000
Accepted: 4 May 2000
The present address of Carlos Arregui is INTECH, Camino Circunvalación Km 6, CC164, 7130 Chascomús, Argentina. The present address of J. Lilien and J. Balsamo is Department of Biological Sciences, University of Iowa, Iowa City, IA 52242-1324.
| References |
|---|
|
|
|---|
Aberle H., Schwartz H. & Kemler R.. Cadherin catenin complexprotein interactions and their implications for cadherin function, J. Cell Biochem., 61, 1996, 514–523.[Medline]
Aplin A.E., Howe A., Alahari S.K. & Juliano R.L.. Signal transduction and signal modulation by cell adhesion receptorsthe role of integrins, cadherins, immunoglobulin-cell adhesion molecules, and selectins, Pharm. Rev., 50, 1998, 199–263.
Arregui C., Lilien J. & Balsamo J.. Impaired integrin-mediated adhesion and signaling in fibroblasts expressing a dominant negative mutant PTP1B, J. Cell Biol., 143, 1998, 861–873.
Balsamo J., Ernst H., Zanin M.K., Hoffman S. & Lilien J.. The interaction of the retina cell surface N-acetylgalactosaminylphosphotransferase with an endogenous proteoglycan ligand results in inhibition of cadherin-mediated adhesion, J. Cell Biol., 129, 1995, 1391–1401.
Balsamo J., Thiboldeaux R., Swaminathan N. & Lilien J.. Antibodies to the retina N-acetylgalactosaminylphosphotransferase modulate N-cadherin–mediated adhesion and uncouple the N-cadherin transferase complex from the actin-containing cytoskeleton, J. Cell Biol., 113, 1991, 429–436.
Balsamo J., Hoffman S. & Lilien J.. Control of cadherin-mediated cell-cell adhesion through regulated association with the cytoskeleton, J. Braz. Assoc. Adv. Sci., 48, 1996, 341–346.
Balsamo J., Leung T., Ernst H., Zanin M.K.B., Hoffman S. & Lilien J.. Regulated binding of a PTP1B-like phosphatase to N-cadherincontrol of cadherin-mediated adhesion by dephosphorylation of β-catenin, J. Cell Biol., 134, 1996, 801–813.
Balsamo J., Arregui C., Leung T.-C. & Lilien J.. The nonreceptor protein tyrosine phosphatase PTP1B binds to the cytoplasmic domain of N-cadherin and regulates the cadherin–actin linkage, J. Cell Biol., 143, 1998, 523–532.
Beauvais-Jouneau A. & Thiery J.P.. Multiple roles of integrins during development, Biol. Cell., 89, 1997, 5–11.[Medline]
Birge B., Fagardo J., Mayer B. & Hanafusa H.. Tyrosine phosphorylated epidermal growth factor receptor and p130 provide high affinity binding substrates to analyze Crk-phosphotyrosine-dependent interactions in vitro, J. Biol. Chem., 267, 1992, 10588–10595.
Bixby J.L. & Zhang R.. Purified N-cadherin is a potent substrate for the rapid induction of neurite outgrowth, J. Cell Biol., 110, 1990, 1253–1260.
Brieher W.M., Yap A.S. & Gumbiner B.. Lateral dimerization is required for the homophilic binding activity of C-cadherin, J. Cell Biol., 135, 1996, 487–496.
Cheresh D.A.. Integrinsstructure, function, and biological properties, Adv. Mol. Cell. Biol., 6, 1993, 225–252.
Craig A.W.B., Zirngibl R. & Greer P.. Disruption of coiled-coil domains in Fer protein tyrosine kinase abolishes trimerization but not kinase activity, J. Biol. Chem., 274, 1999, 19934–19942.
Critchley D.R., Holt M.R., Barry S.T., Priddle H., Hemmings L. & Norman J.. Integrin-mediated cell adhesionthe cytoskeletal connection, Biochem. Soc. Symp., 65, 1999, 79–99.[Medline]
Daniel J.M. & Reynolds A.B.. Tyrosine phosphorylation and cadherin/catenin function, Bioessays., 19, 1997, 883–891.[Medline]
de Curtis I. & Reichardt L.F.. Function and spatial distribution in developing chick retina of the laminin receptor alpha6 beta1 and its isoforms, Development., 18, 1993, 377–388.
Derossi D., Joliot A.H., Chassaing G. & Prochiantz A.. The third helix of the antennapedia homeodomain translocates through biological membranes, J. Biol. Chem., 269, 1994, 10444–10450.
Finnemann S., Kühl M., Otto G. & Wedlich D.. Cadherin transfection of Xenopus XTC cells downregulates expression of substrate adhesion molecules, Mol. Cell. Biol., 15, 1995, 5082–5091.[Abstract]
Fukuda T., Kawano H., Ohyama K., Li H.P., Takeda Y., Oohira A. & Kawamura K.. Immunohistochemical localization of neurocan and L1 in the formation of thalamocortical pathway of developing rats, J. Comp. Neurol., 382, 1997, 141–152.[Medline]
Garton A.J., Burnbaum M.R., Bouton A.H. & Tonks N.K.. Association of PTP-PEST with the SH3 domain of p130cas; a novel mechanism of protein tyrosine phosphatase substrate recognition, Oncogene., 15, 1997, 877–885.[Medline]
Greve J.M. & Gottlieb D.I.. Monoclonal antibodies which alter the morphology of cultured chick myogenic cells, J. Cell Biochem., 18, 1982, 221–229.[Medline]
Hall H., Williams E.J., Moore S.E., Walsh F.S., Prochiantz A. & Doherty P.. Inhibition of FGF-stimulated phosphatidylinositol hydrolysis and neurite outgrowth by a cell-membrane permeable phosphopeptide, Curr. Biol., 6, 1996, 580–587.[Medline]
Hatta K. & Takeichi M.. Expression of N-cadherin adhesion molecules associated with early morphogenetic events in chick development, Nature., 320, 1986, 447–449.[Medline]
Hemler M.E.. Integrin associated proteins, Curr. Opin. Cell Biol., 10, 1998, 578–585.[Medline]
Hodivala K.J. & Watt F.M.. Evidence that cadherins play a role in the downregulation of integrin expression that occurs during keratinocyte terminal differentiation, J. Cell Biol., 124, 1994, 589–600.
Huber A.H., Stewart D.B., Laurents D.V., Nelson W.J. & Weis W.I.. Physical characterization of the cadherin cytoplasmic domain and its interactions with β-catenin, Mol. Biol. Cell., 10, 1999, 70a.
Huttenlocher A., Lakonishok M., Kinder M., Wu S., Truong T., Knudsen K.A. & Horwitz A.F.. Integrin and cadherin synergy regulates contact inhibition of migration and motile activity, J. Cell Biol., 141, 1998, 515–526.
Hynes R.O.. Integrinsversatility, modulation, and signaling in cell adhesion, Cell., 69, 1992, 11–25.[Medline]
Jou T.-S., Stewart D.B., Stappert J., Nelson W.J. & Marrs J.A.. Genetic and biochemical dissection of protein linkages in the cadherin-catenin complex, Proc. Natl. Acad. Sci. USA., 92, 1995, 5067–5071.
Kim L. & Wong T.W.. The cytoplasmic tyrosine kinase FER is associated with the catenin-like substrate p120 and is activated by growth factors, Mol. Cell. Biol., 15, 1995, 4553–4561.[Abstract]
Kim L. & Wong T.W.. Growth factor-dependent phosphorylation of the actin-binding protein cortactin is mediated by the cytoplasmic tyrosine kinase Fer, J. Biol. Chem., 273, 1998, 23542–23548.
Kintner C.. Regulation of embryonic cell adhesion by the cadherin cytoplasmic domain, Cell., 69, 1992, 225–236.[Medline]
Klemke R.L., Leng J., Molander R., Brooks P.C., Vuori K. & Cheresh D.A.. CAS/Crk coupling serves a molecular switch for induction of cell migration, J. Cell Biol., 140, 1998, 961–972.
Li H., Balsamo J., Hoffman S., Leung T.-C. & Lilien J.. Cloning and identification of the domain of chick neurocan essential for coordinate inhibition of cadherin and integrin function, J. Cell Biol., 149, 2000, 1275–1288.
Lilien J., Hoffman S., Eisenberg C. & Balsamo J.. β-Catenin is a target for extracellular signals controlling cadherin functionthe neurocan GalNAcPTase connection, Pedersen R.A. & Schatten G., Current Topics in Developmental Biology. Vol. 35, 1997, 161–189, Academic Press, San Diego.
Liu F., Hill D.E. & Chernoff J.. Direct binding of the proline-rich region of protein tyrosine phosphatase 1B to the Src homology 3 domain of p130cas, J. Biol. Chem., 271, 1996, 31290–31295.
Lu Q., Paredes M., Zhang J. & Kosik K.S.. Basal extracellular signal-regulated kinase activity modulates cell-cell and cell-matrix interactions, Mol. Cell. Biol., 18, 1998, 3257–3265.
Lupas A.. Coiled coilsnew structures and new functions, Trends Biochem. Sci., 21, 1996, 375–382.[Medline]
Margolis R.K., Rauch U., Maurel P. & Margolis R.U.. Neurocan and phosphocantwo major nervous system specific chondroitin sulfate proteoglycans, Perspec. Dev. Neurobiol., 3, 1996, 273–290.
Marrs J.A. & Nelson W.J.. Cadherin cell adhesion molecules in differentiation and embryogenesis, Int. Rev. Cytol., 165, 1996, 159–205.[Medline]
Matsuda M. & Kurata T.. Emerging components of the Crk oncogene productthe first identified adaptor protein, Cell Signal., 8, 1996, 335–340.[Medline]
Matsui F., Nishizuka M., Yasuda Y., Aono S., Watanabe E. & Oohira A.. Occurrence of a N-terminal proteolytic fragment of neurocan, not a C-terminal half, in a perineuronal net in the adult rat cerebrum, Brain Res., 790, 1998, 45–51.[Medline]
Meyer-Puttlitz B., Milev P., Junker E., Zimmer I., Margolis R.U. & Margolis R.K.. Chondroitin sulfate and chondroitin/keratan sulfate proteoglycans of nervous tissuedevelopmental changes of neurocan and phosphocan, J. Neurochem., 65, 1995, 2327–2337.[Medline]
Monier-Gavelle F. & Duband J.-L.. Cross talk between adhesion moleculescontrol of N-cadherin activity by intracellular signals elicited by β1 and β3 integrins in migrating neural crest cells, J. Cell Biol., 137, 1997, 1663–1681.
Nagafuchi A. & Takeichi M.. Transmembrane control of cadherin-mediated cell adhesiona 94kDa protein functionally associated with a specific region of the cytoplasmic domain of E-cadherin, Cell Regul., 1, 1989, 37–44.[Medline]
Nojima Y., Morino N., Mimura T., Hamasaki K., Furuya H., Sakai R., Sato T., Tachibana K., Morimoto C., Yazaki Y. & Hirai H.. Integrin-mediated cell adhesion promotes tyrosine phosphorylation of p130cas, a Src-homology 3-containing molecule having multiple Src homology 2-binding motifs, J. Biol. Chem., 270, 1995, 15398–15402.
Ohkubo T. & Ozawa M.. p120ctn binds to the membrane-proximal region of the E-cadherin cytoplasmic domain and is involved in modulation of adhesion activity, J. Biol. Chem., 274, 1999, 21409–21415.
Oohira A., Matsui F., Watanabe E., Kushima Y. & Maeda N.. Developmentally regulated expression of a brain specific species of chondroitin sulfate proteoglycan, neurocan, identified with a monoclonal antibody Ig2 in the rat cerebrum, Neurosci., 60, 1994, 145–157.[Medline]
Ozawa M. & Kemler R.. The membrane-proximal region of the E-cadherin cytoplasmic domain prevents dimerization and negatively regulates adhesion activity, J. Cell Biol., 142, 1998, 1605–1613.
Petch L.A., Bockholt S.M., Bouton A., Parsons J.T. & Burridge K.. Adhesion induced tyrosine phosphorylation of the p130 src substrate, J. Cell Sci., 108, 1995, 1371–1379.[Abstract]
Polte T.R. & Hanks S.K.. Interaction between focal adhesion kinase and Crk-associated tyrosine kinase substrate p130cas, Proc. Natl. Acad. Sci. USA., 92, 1995, 10678–10682.
Prochiantz A.. Getting hydrophilic compounds into cellslessons from homeopeptides, Curr. Opin. Neurobiol., 6, 1996, 629–634.[Medline]
Reynolds A.B., Daniel J.M., McCrea P.D., Wheelock M.J., Wu J. & Zhang Z.. Identification of a new cateninthe tyrosine kinase substrate p120cas associates with E-cadherin complexes, Mol. Cell. Biol., 14, 1994, 8333–8342.
Riehl R., Johnson K., Bradley R., Grunwald G.B., Cornel E., Lilienbaum A. & Holt C.E.. Cadherin function is required for axon outgrowth in retinal ganglion cells in vivo, Neuron., 17, 1996, 837–848.[Medline]
Rosato R., Veltmaat J.M., Groffen J. & Heisterkamp N.. Involvement of the tyrosine kinase Fer in cell adhesion, Mol. Cell. Biol., 18, 1998, 5762–5770.
Roura S., Miravet S., Piedra J., de Herreros A.G. & Duñach M.. Regulation of E-cadherin/catenin association by tyrosine phosphorylation, J. Biol. Chem., 274, 1999, 36734–36740.
Sakai R., Iwamatsu A., Hirano N., Ogawa S., Tanaka T., Mano H., Yazaki Y. & Hirai H.. A novel signaling molecule, p130 forms stable complexes in vivo with v-Crk and v-Src in a tyrosine phosphorylation dependent manner, EMBO (Eur. Mol. Biol. Organ.) J., 15, 1994, 3748–3756.
Schoenwaelder S.M. & Burridge K.. Bidirectional signaling between the cytoskeleton and integrins, Curr. Opin. Cell Biol., 11, 1999, 274–286.[Medline]
Semb H. & Christofori G.. Insights from model systemsthe tumor suppressor function of E-cadherin, Am. J. Hum. Genet., 63, 1998, 1588–1593.[Medline]
Smithgall T.E., Rogers J.A., Peters K.L., Li J., Briggs S.D., Lionberger J.M., Cheng H., Shibata A., Scholtz B., Schreiner S. & Dunham N.. The c-Fes family of protein-tyrosine kinases, Crit. Rev. Oncog., 9, 1998, 43–62.[Medline]
Stappert J. & Kemler R.. A short core region of E-cadherin is essential for catenin binding and is highly phosphorylated, Cell Adhes. Comm., 2, 1994, 319–327.[Medline]
Takeda H., Shimoyamo Y., Nagafuchi A. & Hirohashi S.. E-cadherin functions as a cis-dimer at the cell-cell adhesive interface in vivo, Nat. Struct. Biol., 6, 1999, 310–312.[Medline]
Thoreson M.A., Anastasiadis P.Z., Daniel J.M., Ireton R.C., Wheelock M.J., Johnson K.R., Hummingbird D.K. & Reynolds A.B.. Selective uncoupling of p120ctn from E-cadherin disrupts strong adhesion, J. Cell Biol., 148, 2000, 189–201.
Tomaselli K.J., Reichardt L.F. & Bixby J.L.. Distinct molecular interactions mediate process outgrowth on nonneuronal cell surfaces and extracellular matrices, J. Cell Biol., 106, 1986, 2659–2672.[Medline]
Tomaselli K.J., Hall D.E., Flier L.A., Gehlsen K.R., Turner D.C., Carbonetto S. & Reichardt L.F.. A neuronal cell line (PC12) expresses two β1-class integrins
1β1 and
3β1, that recognize different neurite outgrowth-promoting domains in laminin, Neuron., 5, 1990, 651–662.[Medline]
Varner J.A. & Cheresh D.A.. Integrins and cancer, Curr. Opin. Cell Biol., 8, 1996, 724–730.[Medline]
Vleminckx K. & Kemler R.. Cadherins and tissue formationintegrated adhesion and signaling, Bioessays., 21, 1999, 211–220.[Medline]
Vuori K. & Ruoslahti E.. Tyrosine phosphorylation of p130cas and cortactin accompanies integrin-mediated cell adhesion to extracellular matrix, J. Biol. Chem., 270, 1995, 22257–22262.
Wheelock M.J., Knudsen K.A. & Johnson K.R.. Membrane-cytoskeleton interactions with cadherin cell adhesion proteinsroles of catenins as linker proteins, Curr. Top. Membr., 43, 1996, 169–185.
Wu C., Keightley S.Y., Leung-Hagesteijn C., Radeva G., Coppolino M., Goicoechea S., McDonald J.A. & Dedhar S.. Integrin-linked protein kinase regulates fibronectin matrix assembly, E-cadherin expression, and tumorigenicity, J. Biol. Chem., 273, 1998, 528–536.
Xu Y. & Carpenter G.. Identification of cadherin tyrosine residues that are phosphorylated and mediate Shc association, J. Cell Biochem., 75, 1999, 264–271.[Medline]
Xu Y., Guo D.-F., Davidson M., Inagami T. & Carpenter G.. Interaction of the adaptor protein Shc and the adhesion molecule cadherin, J. Biol. Chem., 272, 1997, 13463–13466.
Yap A.S., Brieher W.M., Pruschy M. & Gumbiner B.. Lateral clustering of the adhesive ectodomaina fundamental determinant of cadherin function, Curr. Biol., 7, 1997, 308–315a.[Medline]
Yap A.S., Brieher W.M. & Gumbiner B.. Molecular and functional analysis of cadherin-based adherens junctions, Annu. Rev. Cell Dev. Biol., 13, 1997, 119–146b.[Medline]
Yap A.S., Niessen C.M. & Gumbiner B.M.. The juxtamembrane region of the cadherin cytoplasmic tail supports lateral clustering, adhesive strengthening, and interaction with p120ctn, J. Cell Biol., 141, 1998, 779–789.
Zhu A.J. & Watt F.M.. Expression of a dominant negative cadherin mutant inhibits proliferation and stimulates terminal differentiation of human epidermal keratinocytes, J. Cell Sci., 109, 1996, 3013–3023.[Abstract]
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|