JCB logo
CrossRef
  Home | Help | Feedback | Subscriptions | Archive | Search | Table of Contents

This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF, 645K)
Right arrow PPT slides of all figures
Right arrow Alert me when this article is cited
Right arrow Citation Map
Services
Right arrow Email this article
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new content in the JCB
Right arrow Download to citation manager
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via CrossRef
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Li, H.
Right arrow Articles by Lilien, J.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Li, H.
Right arrow Articles by Lilien, J.
Related Collections
Right arrowRelated Article
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Facebook   Add to Reddit   Add to Technorati   Add to Twitter  
What's this?

© The Rockefeller University Press, 0021-9525/2000//1275 $5.00
The Journal of Cell Biology, Volume 149, Number 6, , 2000 1275-1288


Original Article

Coordinate Regulation of Cadherin and Integrin Function by the Chondroitin Sulfate Proteoglycan Neurocan



Hedong Lia, Tin-Chung Leunga, Stanley Hoffmanb, Janne Balsamoa, and Jack Liliena

a Department of Biological Sciences, Wayne State University, Detroit, Michigan 48202
b Division of Rheumatology and Immunology, Medical University of South Carolina, Charleston, South Carolina 29425-2229
Department of Biological Sciences, Wayne State University, Detroit, MI 48202.(313) 577-6891(313) 577-0133

jlilien{at}biology.biosci.wayne.edu

N-cadherin and β1-integrins play decisive roles in morphogenesis and neurite extension and are often present on the same cell. Therefore, the function of these two types of adhesion systems must be coordinated in time and space to achieve the appropriate cell and tissue organization. We now show that interaction of the chondroitin sulfate proteoglycan neurocan with its GalNAcPTase receptor coordinately inhibits both N-cadherin– and β1-integrin–mediated adhesion and neurite outgrowth. Furthermore, the inhibitory activity is localized to an NH2-terminal fragment of neurocan containing an Ig loop and an HA-binding domain. The effect of neurocan on β1-integrin function is dependent on a signal originating from the cadherin cytoplasmic domain, possibly mediated by the nonreceptor protein tyrosine kinase Fer, indicating that cadherin and integrin engage in direct cross-talk. In the developing chick, neural retina neurocan is present in the inner plexiform layer from day 7 on, and the GalNAcPTase receptor becomes restricted to the inner nuclear layer and the ganglion cell layer (as well as the fiber layer), the two forming a sandwich. These data suggest that the coordinate inhibition of cadherin and integrin function on interaction of neurocan with its receptor may prevent cell and neurite migration across boundaries.

Key Words: cadherin • integrin • adhesion • neurite outgrowth • tyrosine kinase Fer



© 2000 The Rockefeller University Press


   Introduction
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
The characteristic cellular patterns that arise during development are a result of complex cell and tissue rearrangements. Nowhere is this complexity more apparent than in the development of the nervous system. The number and type of cell-surface receptors that transduce signals from environmental cues to the cytoplasmic machinery that ultimately directs growth cone guidance are extensive. Environmental cues too come in many forms including the following: diffusible molecules, cell-surface molecules, and extracellular matrix molecules. Whereas the identity of the cell-surface receptors, their environmental triggers, and even the nature of many of the signaling pathways has been unfolding apace (for reviews see Goodman and Tessier-Lavigne 1997; Mueller 1999; Song and Poo 1999), the machinery that integrates and coordinates the responses to various cues within a single growth cone remains relatively unknown.

β1-Integrins and N-cadherin have long been recognized as two transmembrane adhesion receptors critical to neurite outgrowth (Bixby et al. 1988; Neugebauer et al. 1988; Tomaselli et al. 1989). We have previously suggested that a cell-surface glycosyltransferase (GalNAcPTase) may be a critical component of one regulatory circuit that coordinates the activity of these two adhesion systems (Gaya-Gonzalez et al. 1991; Lilien et al. 1997, Lilien et al. 1999). The GalNAcPTase is anchored to the plasma membrane by a glycophosphatidylinositide linkage (Balsamo and Lilien 1993), and specifically associates with N- and E-cadherin (Balsamo and Lilien 1990; Bauer et al. 1992) but not β1-integrins (Lilien et al. 1999). Binding of one unique mAb to the GalNAcPTase initiates a signal that results in coordinate inhibition of N-cadherin and β1-integrin–mediated neurite outgrowth (Gaya-Gonzalez et al. 1991). We hypothesized that the activity of this antibody reflected the activity of an endogenous ligand. Indeed, we subsequently identified and purified a 250-kD chondroitin sulfate proteoglycan (250kD PG) that binds to the same, or an overlapping, domain of the GalNAcPTase. It also initiates a signal that results in retention of the phosphate on tyrosine residues of β-catenin and uncoupling of cadherin from its association with actin, with concomitant inhibition of N-cadherin–mediated adhesion and neurite outgrowth (Balsamo et al. 1995, Balsamo et al. 1996).

To further study the molecular mechanism of the interaction between 250kD PG and its receptor, GalNAcPTase, we have isolated the complete cDNA coding for the 250kD PG and show that binding of the protein backbone to the GalNAcPTase initiates a signal cascade that results in coordinate inhibition of cadherin- and integrin-mediated adhesion and neurite outgrowth. Sequence analysis shows that the 250kD PG is the chicken homologue of neurocan. Chicken neurocan contains the conserved NH2- and COOH-terminal protein motifs characteristic of the aggrecan/versican/neurocan/brevican family of chondroitin sulfate proteoglycans (Ruoslahti 1996; Schwartz et al. 1999). The conserved motifs are ~70% similar to rat neurocan, but there is little sequence similarity (<10%) in the central region, where the majority of the consensus sites for attachment of chondroitin sulfate side chains occur. The coordinate regulation of cadherin and integrin function is due to a direct interaction between the NH2 terminus of neurocan containing the Ig loop and hyaluronic acid (HA-binding) domain and the GalNAcPTase, as removal of the GalNAcPTase with PI-PLC abrogates the coordinate regulatory activity. Furthermore, coordinate regulation appears to be due to a signal originating from the cytoplasmic domain of cadherin directly affecting integrin function. Our results suggest a mechanism whereby neurite outgrowth may be directionally controlled by environmental cues defining axonal trajectories.


   Materials and Methods
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Antibodies
Preparation of anti-PG250 antibody (Balsamo et al. 1995) and the antineurocan antibody (Zanin et al. 1999) were described previously. Anti–N-cadherin antibody NCD-2 is a monoclonal rat IgG (the cell line was provided by M. Takeichi, Kyoto University, Kyoto, Japan; Hatta and Takeichi 1986). The anti–β1-integrin antibody, JG22, is a mouse monoclonal IgG (Greve and Gottlieb 1982; Tomaselli et al. 1986) and the anti-FAK antibody is a monoclonal IgG (Transduction Laboratories). Anti–β-catenin antibodies are a rabbit polyclonal IgG directed against a synthetic 15-amino acid sequence (Balsamo et al. 1995) and a mouse mAb (Transduction Laboratories). The antiactin antibody is a monoclonal mouse IgG (Chemicon International, Inc.). The antiphosphotyrosine antibody, PY20, was purchased from Transduction Laboratories. Two anti-GalNAcPTase antibodies, 1B11 and 7A2, are mouse IgMs prepared as described previously (Scott et al. 1990; Balsamo et al. 1991). Antisyntaxin antibody HPC-1 is a mouse monoclonal IgG purchased from Sigma Chemical Co. The following three mAbs were provided by Dr. Vance Lemmon (Case Western Reserve University, Cleveland, OH): 8D9 (anti-chicken L1), 3G3, and 3A7. Secondary antibodies, Cy3-conjugated goat anti–mouse IgG, FITC-conjugated donkey anti–rat IgG, FITC-conjugated goat anti–rabbit IgG, and rhodamine-conjugated goat anti–mouse IgM were purchased from Jackson ImmunoResearch Laboratories, Inc.

Isolation of the cDNA Encoding Neurocan
Total RNA was purified from day 10 embryonic chicken brain (E10) and retina using an RNeasy kit (Qiagen). RNA was reverse transcribed into first-strand cDNA using a degenerate primer based on the amino acid sequence of the most highly conserved region of the HA-binding domain present in all members of the hyaluronic acid binding family of proteins, CDAGWL: 5'-A(GA)CCAICCIGC(AG)TC(AG)CA-3' (Rauch et al. 1992). PCR was performed using two sets of nonoverlapping primers derived from microsequencing of the NH2 terminus and a cyanogen bromide fragment of the 250 kD PG core protein. Inosine (I) was used to reduce degeneracy.

The NH2-terminal amino acid sequence with the two nested primers underlined are as follows: DQDEGKVIHISRVQHQAVRVGLGEPVALP, 5'-GGIAA(AG)GTIATICA(CT)ATI(AT(GC)I(AC)GIGTICA-3'; and 5'-GTIGGI(TC)TIGGIGA(AG)CCIGTIGCI(TC)TICC-3'. The internal sequence with two nested primers underlined are as follows: DNSAVIASPQHLQ... and ...QAAFEDGYDN, 5'-TT(AG)TC(AG)-TAICC(AG)TC(TC)TC(AG)AAIGCIGC(TC)TG-3'; and 5'-TGIA-(AG)(AG)TG(TC)TGIGGI(GC)(AT)IGCIATIACIGC-3'.

A 450-bp product was obtained, subcloned into the TA vector (Invitrogen Corp.) and sequenced. This sequence showed 71% similarity to rat and mouse neurocan. The PCR product was radiolabeled and used as a probe to screen a chick brain {lambda}-Zap cDNA library. Eight positive clones were isolated and cloned into pBluescript SK (Stratagene). Restriction pattern analysis revealed two distinct clones with inserts of 1.8 and 2.0 kb, with 1.5 kb of overlap yielding 2.3 kb of unique sequence. To obtain the full-length cDNA sequence, reverse transcriptase-inverse-PCR was used (Zeiner and Gehring 1994). In brief, first-strand cDNA was made from E10 chick brain total RNA using an oligo-dT primer, followed by second-strand cDNA synthesis and blunt-end circularization of the double-stranded cDNA. The circularized cDNA was used as a template for a set of nested primers based on the 5' and 3' ends of the 2.3 kb of known sequence pointing away from the known sequence, allowing amplification of regions flanking the 2.3-kb fragment. A complete clone was constructed by recombinant PCR using the high fidelity polymerase, elongase (GIBCO BRL) and sequenced (sequence data available from GenBank/EMBL/DDBJ under accession number AF116856).

Northern Blot Analysis
Total RNA was isolated from E10 chick brains using the RNeasy kit (Qiagen). 5 µg of total RNA was separated on 1% denaturing agarose gel, transferred to Hybond-N+ membrane (Amersham), and hybridized with a probe of 1.1 kb from the central region of the cDNA sequence. This probe was used as it is the least conserved region of the full-length clone. After high stringency washes, (0.1x SSPE, 0.1% SDS) the membrane was exposed to Biomax X-film (Eastman Kodak Co.).

Preparation of Recombinant His-tagged Bacterial Fusion Protein
The complete open reading frame lacking the signal peptide (nucleotides 128–4467), with adaptor sequences, was obtained by PCR, digested with NdeI and BglII, and ligated into pET-15b (Novagen, Inc.), which was predigested with the same enzymes. Fusion protein fragments representing the NH2- and COOH-terminal domains were generated as follows (see Fig. 2). An NH2-terminal fragment was generated by cutting the full-length construct with NdeI and partially with XhoI, ligating the released DNA fragment containing nucleotides 128–1400 into the pET-15b vector that was predigested with the same enzymes. A COOH-terminal fragment was generated by cutting the full-length construct with BamHI and the released DNA fragment, containing nucleotides 2668–4467, was ligated into BamHI-linearized pET-15b vector. The NH2-terminal construct was further cut with XhoI to generate an Ig (nucleotides 128–518) and an HA (nucleotides 518–1400) fragment. A second Ig fragment containing a piece of HA-binding region was generated by PCR using the 5' primer used to clone the complete open reading frame and a 3' primer corresponding to nucleotides 599–622. All fragments were also ligated into pET-15b at appropriate restriction sites and confirmed by sequencing. The constructs were transformed into BL21(DE) (Novagen, Inc.), and induced bacteria were pelleted and stored at –80°C until needed. Fusion proteins were extracted from the cell pellet in buffer containing 6 M urea, purified on Ni2+ columns following the manufacturer's recommendations (Novagen, Inc.), and renatured by a series of dialyses in PBS with 0.1 mM DTT. The final products were aliquoted and frozen at –80°C.


Figure 2
View larger version (12K):
[in this window]
[in a new window]
[Download PPT slide]
 
Figure 2 (A) Diagram of chick neurocan showing its multiple domains and (B) the regions expressed as fusion peptides. N indicates the position of potential N-linked oligosaccharides, and cs indicates potential chondroitin sulfate attachment sites. RGD indicates the presence of the consensus integrin-binding sequence (Arg-Gly-Asp). SP refers to the signal peptide and CRL to complement regulatory-like domain. Small numbers refer to residue number.

 
Single Cell Preparation and Adhesion Assays
For N-cadherin–mediated adhesion, E9 chick neural retina single cells were prepared by trypsinization of tissues in the presence of 1 mM Ca2+ as previously described (Balsamo et al. 1995) with minor modifications. Single cells were washed 2x in HBSGKCa (20 mM Hepes, pH 7.4, 150 mM NaCl, 2 mM glucose, 3 mM KCl, and 1 mM CaCl2) and resuspended in HBSGKCa at 2 x 107 cells/ml. For integrin-mediated adhesion, E9 chick neural retina cells were prepared as above; however, calcium was omitted and trypsinization was performed for 10 min in contrast to the usual 30 min. The cells were preincubated on ice for 15 min with or without additives and 100-µl aliquots containing 105 cells were added to each well of a 96-well plate previously coated with N-cadherin or laminin. Glass coverslips were coated with 250 µg/ml poly-L-lysine (Sigma Chemical Co.) at 37°C for 2 h, washed with water, and postcoated with NCD-2 or laminin as described previously (Arregui et al. 1999). The coverslips were subsequently blocked with 1% BSA in HBSGK for a minimum of 2 h at room temperature. E7 chick neural retina cells (105 cells/ml), prepared by trypsinization in the absence of Ca2+, were plated on each coverslip in F12 medium (GIBCO BRL) including 1% ITS (insulin/transferin/selenium; GIBCO BRL), 2% glucose, and 0.5% gentamycin (Sigma Chemical Co.) as previously described (Gaya-Gonzalez et al. 1991). After 2 h in culture, and thereafter every 3 h, neurocan peptides were added to the culture medium. After 12 h, cells were fixed with 4% paraformaldehyde in PBS for 30 min at room temperature and images captured with a SenSys CCD camera (Photometrics) and analyzed with a Metamorph image analysis system. Cells bearing neurites longer than one cell diameter were considered positive for neurite extension.

Interaction of Neurocan with the Cell-surface GalNAcPTase
E9 retina cells, prepared by trypsinization in the presence of Ca2+ as described above, were incubated with neurocan fusion peptides (~20 x 106 cells/100 µl of HBSGKCa containing ~0.2 mM fusion peptide or BSA) for 1 h at 4°C. Cells were pelleted, resuspended in 0.25 mM DTSSP cross-linker (Pierce Chemical Co.) in PBS, and incubated at 4°C for 30 min. The cells were again pelleted, washed in HBSGKCa, and lysed in homogenization buffer (1% Triton X-100, 20 mM Tris, pH 7.5, 150 mM NaCl, 1:1,000 AESBF [Sigma Chemical Co.], 100 µg/ml DNase, 2 mM o-vanadate, 1 mM NaF) at 4°C for 30 min. The lysates were centrifuged at 14,000 g for 5 min, and the supernatant was mixed with an equal volume of Immunomix (1% Triton X-100, 0.5% DOC, 1% SDS, 0.1% BSA in 25 mM Tris, pH 7.9, 150 mM NaCl, 1 mM PMSF). The solution was cleared by centrifugation and incubated with monoclonal anti-GalNAcPTase antibody for 2 h at 4°C. The precipitates were collected using goat anti–mouse IgM attached to magnetic beads, washed in Immunomix, and fractionated by SDS-PAGE. Western transfers were probed with polyclonal antineurocan antibody or HRP nickel (KPL) as previously described (Balsamo et al. 1995). As controls, peptides were added to cells immediately after treatment with the cross-linking reagent.

Association of N-Cadherin with the Actin Cytoskeleton
Coprecipitation of N-cadherin and actin was carried out as previously described (Balsamo et al. 1991) with minor modifications. 105 E9 chick retina cells (see above) were preincubated with or without neurocan peptides for 5 or 15 min on ice, in a total volume of 0.5 ml, followed by 5 min at 37°C and 120 rpm. The cells were pelleted and lysed on ice in 1 ml of homogenization buffer for 30 min. The lysates were centrifuged at 14,000 g for 5 min, and the supernatants were incubated with anti–N-cadherin antibody NCD-2 (5 µg/ml) under constant rotation at 4°C for 4 h. The samples were incubated for an additional 1 h with goat anti–rat IgG-conjugated magnetic beads (PerSeptive Biosystems), washed four times in homogenization buffer, boiled in 50 µl of SDS sample buffer for 5 min, fractionated by SDS-PAGE, and Western transfers were probed with antiactin antibody and the anti–N-cadherin antibody NCD-2 as described previously (Balsamo et al. 1995).

Tyrosine Phosphorylation of β-Catenin
Cells were treated as above for coprecipitation of actin and N-cadherin, with the exception that all cell homogenates were made 1% in SDS to disrupt protein–protein interactions. The cell lysate was diluted to 0.1% SDS with homogenization buffer, and immunoprecipitated with anti–β-catenin antiserum (1:100). The immunoprecipitates were fractionated by SDS-PAGE and Western transfers were probed with antiphosphotyrosine antibody (PY 20; Transduction Laboratories), followed by HRP-conjugated goat anti–mouse IgG. The membranes were stripped and reprobed with anti–β-catenin antibody (Transduction Laboratories) and developed with alkaline phosphatase–conjugated goat anti–rabbit IgG (Jackson ImmunoResearch Laboratories, Inc.).

Cell Permeable Peptides
Peptides containing the cell permeable sequence derived from the antennapedia homeodomain (Perez et al. 1992; Derossi et al. 1994; Prochiantz 1996) and sequences from the N-cadherin cytoplasmic domain (Arregui et al. 2000) were synthesized and purified to >90% by HPLC (Genemed Biotechnologies, Inc.). All peptides were dissolved in sterile deionized water, stored in small aliquots at –70°C, and used at 2 µM, a concentration that gives maximal inhibition without toxicity (Arregui et al. 2000). The three peptides used are as follows: COP, RQIKIWFQNRRMKWKK (antennapedia sequence alone); CBP, RQIKIWFQNRRMKWKKSLLVFDYEGSGSTAGSLSSL (antennapedia plus the β-catenin binding region); and JMP, RQIKIWFQNRRMKWKKRQAKQLLIDPEDDVRDNILK (antennapedia plus the juxtamembrane region).

Immunohistochemistry
Chicken eyes from embryos at different ages were carefully dissected in cold PBS, and fixed in freshly made 4% paraformaldehyde at 4°C overnight. Fixed eyes were washed three times in PBS (10–15 min each), and the neural retina and pigmented retina layers were removed and maintained in 30% sucrose in PBS overnight at 4°C and frozen in Histoprep medium (Fisher Scientific) at –80°C. 20-µm sections were cut at –25°C, picked up on gelatin-coated coverslips, air-dried on a 37°C hot plate, and frozen at –20°C. Before staining, the sections were heated to 60°C on a hot plate, rehydrated, and washed three times with PBS. After blocking with 3% goat serum in PBS for 2 h at room temperature, the sections were incubated with the appropriate primary antibody in 3% goat serum in PBS at room temperature for 1 h. After washing three times with PBS, the sections were incubated with secondary antibody in 3% goat serum in PBS at room temperature for 1 h, followed by another three washes with PBS. Finally, the sections were mounted on slides with Vectashield (Vector Laboratories, Inc.) antifading mounting medium, sealed with nail polish, and analyzed as for neurite outgrowth.

Single cells were prepared and plated on laminin-coated coverslips as described above for neurite outgrowth assays at a density of 100,000 cells/coverslip. The cells were cultured overnight, and fixed in 4% paraformaldehyde for 20 min at room temperature. For immunostaining, cells were treated similarly to tissue sections, except that 0.4% saponin was included in the incubation buffer when cell permeabilization was required. Tissue sections and cells were observed under phase and epifluorescence using a Zeiss universal microscope. Images were captured and analyzed as for neurite outgrowth.


   Results
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
The 250kD PG cDNA Encodes the Chicken Homologue of Neurocan
The complete cDNA clone has an open reading frame of 3,861 bp, encoding 1,287 amino acids with a calculated molecular mass of 141.6 kD. This is flanked by 65 bp of 5'-untranslated region, 705 bp of 3'-untranslated region including a polyadenylation signal, AATAAA, and the poly-A tail. Database searches at both the nucleic acid and deduced amino acid levels indicate that the cDNA encodes the chicken homologue of neurocan (Fig. 1). All four neurocans thus far sequenced (rat [Rauch et al. 1992], mouse [Rauch et al. 1995], human [Prange et al. 1998], and chick) are organized similarly: the NH2 terminus contains an Ig-like domain, followed by the hyaluronic acid binding domain, a central region rich in proline, and the COOH terminus with two EGF-like repeats, a lectinlike domain, and a complement regulatory-like domain (Fig. 2). The NH2- and COOH-terminal regions have ~70% sequence identity between chicken and rat, whereas the central region shows little similarity, <10%.


Figure 1
View larger version (116K):
[in this window]
[in a new window]
[Download PPT slide]
 
Figure 1 Sequence comparison between the four cloned neurocans: chicken, human, mouse, and rat. Shaded areas represent identical amino acids, and boxed areas represent conservative changes.

 
Analysis of the deduced amino acid sequence indicates the presence of four NXS/T consensus sequences for potential N-glycosylation (Bause 1983) and six potential GAG attachment sites based on the presence of an SG dipeptide, closely preceded by an acidic amino acid, or followed by XG, where X is any amino acid (Bourdon et al. 1987; Kreuger et al. 1990). Two RGD sequences are also present in the central region of chick neurocan (Fig. 2), whereas the rat has only one (Rauch et al. 1992, Rauch et al. 1995), which is not at the same position as either in the chicken, but none appear in the mouse or human homologues. In addition, the COOH terminus contains a stretch of histidine residues (1,251–1,266; Fig. 1). The entire neurocan molecule appears as two globular domains separated by an extended linear region, composed of the unique central domain that bears all of the chondroitin sulfate side chains (Retzler et al. 1996b). Except for the HA-binding domain, little is known about the physiological or developmental functions of these domains.

Northern analysis with total RNA from E10 chicken brain reveals a single band of ~5.4 kb (not shown). This is significantly smaller than the rat or human mRNA (Rauch et al. 1992; Prange et al. 1998). Given the conserved size of the coding region, this discrepancy in message size is most likely because of the differences in the 3' and/or 5' noncoding regions.

To determine whether the cloned cDNA represented the 250kD PG, recombinant neurocan produced in bacteria was reacted with anti-250kD PG antibody (Fig. 3). Neurocan is recognized by affinity-purified anti-250kD PG antibody. Additional bands recognized by the anti-250kD antibody are most likely degradation products. The recombinant polypeptide has a calculated molecular mass of 141.6 kD, however, the apparent molecular mass on SDS-PAGE is >200 kD. This discrepancy in migration rate was also seen when recombinant rat neurocan was fractionated by SDS-PAGE. This has been attributed to the stiff, rodlike structure of the central region of the molecule (Retzler et al. 1996b).


Figure 3
View larger version (70K):
[in this window]
[in a new window]
[Download PPT slide]
 
Figure 3 Recombinant chick neurocan is recognized by anti-250kD PG antibody. Lysates of bacteria transformed with plasmids containing the complete chick neurocan cDNA were fractionated by SDS-PAGE and stained with Coomassie brilliant blue (CBB), or transferred to polyvinylidene difluoride membranes and immunoblotted with anti-250kD PG antibody. U, lysate from noninduced bacteria; and I, lysate from bacteria induced with IPTG. Numbers to the left refer to the migration of molecular mass markers (10–3).

 
Recombinant Neurocan and Its NH2-terminal Fragment Inhibit N–Cadherin-mediated Adhesion and Neurite Outgrowth
The neurocan polypeptide backbone was expressed as a His-tagged fusion protein, purified on a Ni2+ column, and assayed for its effect on cadherin-mediated adhesion and neurite outgrowth. Full-length neurocan fusion protein (RP) at 20 µg/ml inhibits N–cadherin-mediated cell adhesion by 60% (Fig. 4 A). This indicates that the polypeptide backbone of neurocan is sufficient for inhibition, and that the sugar chains on tissue-derived neurocan core protein are unlikely to be contributing to the inhibitory effect. That the assay reflects N–cadherin-mediated adhesion is seen by the ability of the anti–N-cadherin antibody NCD-2 to completely block adhesion (Fig. 4 A). The anti-GalNAcPTase antibody 1B11 also functionally blocks N–cadherin-mediated adhesion on binding to the cell-surface GalNAcPTase, in agreement with our previous observations (Balsamo et al. 1991).


Figure 4
View larger version (13K):
[in this window]
[in a new window]
[Download PPT slide]
 
Figure 4 Recombinant neurocan and its NH2-terminal fragment inhibit N-cadherin–mediated adhesion. Single cells were prepared from E9 retinas and added to 96-well plates coated with anti–N-cadherin antibody at 37°C for 30 min in the presence of the indicated additives. The plates were washed and adherent cells determined by staining with crystal violet. Adhesion in the absence of any additives was considered 100%. (A) Co, no additives; 1B11, anti-GalNAcPTase antibody; NCD, anti–N-cadherin antibody; RP, full-length recombinant neurocan; RN, NH2-terminal fragment; and RC, COOH-terminal fragment. (B) Adhesion in the presence of increasing concentrations of RN and RC.

 
To define the specific domain of neurocan that is responsible for inhibition of cadherin-mediated adhesion, we prepared His-tagged fusion fragments of neurocan representing the NH2 terminus (RN), containing the Ig-loop and the HA-binding domain, and the COOH terminus (RC), containing the EGF-like repeats, the lectinlike domain, and the complement regulatory-like domain (Fig. 2 B). Treatment of retina cells with the NH2-terminal fragment, but not the COOH-terminal fragment, results in inhibition of cadherin-mediated adhesion by >90% at 10 µg/ml (Fig. 4 A, RN versus RC). Inhibition by the NH2-terminal fragment is dose-dependent exhibiting half maximal inhibition at <5 µg/ml (Fig. 4 B). The fact that the NH2-terminal fragment is more active than the full-length protein may be accounted for by the difficulty of maintaining the full-length protein in a soluble state, possibly because of aggregation. In an attempt to further define the active domain, His-tagged fusion fragments containing the Ig loop alone (Fig. 2 B, Ig1), the Ig loop with a fragment of the HA domain (Fig. 2 B, Ig2) and the HA domain were also assayed. None of these additional fragments are active, nor is simultaneous addition of separate fusion fragments representing the Ig loop and the HA domain (not shown). This indicates that the Ig loop and the HA domain must be contiguous, possibly to maintain a specific configuration.

To further characterize the inhibitory effect of recombinant neurocan and its fragments, we assayed their effect on N–cadherin-mediated neurite outgrowth by E7 retina cells. The results are in agreement with those for adhesion. The NH2-terminal fragment of neurocan, but not the COOH-terminal fragment inhibits neurite extension (Fig. 5A and Fig. B). As for adhesion, inhibition of neurite outgrowth by the anticadherin antibody NCD-2 as well as the anti-GalNAcPTase mAb 1B1 indicate that neurite outgrowth is mediated by N-cadherin. Importantly, neurite outgrowth on poly-L-lysine is unaffected by neurocan (not shown). Thus, it is specifically the function of cadherin (or integrin, see below) that is affected, not other aspects of the machinery required for neurite outgrowth.


Figure 5
View larger version (43K):
[in this window]
[in a new window]
[Download PPT slide]
 
Figure 5 The NH2-terminal fragment of neurocan inhibits N-cadherin–mediated neurite outgrowth. E7 retina cells were plated on anti–N-cadherin–coated coverslips and incubated for 2 h before addition of anti–N-cadherin antibodies (NCD), neurocan NH2-terminal fragment (RN) or COOH-terminal fragment (RC). RN and RC were added to the cultures three more times, after 3-h intervals. The cells were fixed and observed under a microscope. (A) Representative fields of each treatment (RN and RC at 10 µg/ml). (B) The number of cells bearing neurites longer than one cell diameter is expressed as a percentage of the control (number of cells bearing neurites in the absence of additives: 59 ± 7; n = 100). 1B11, anti-GalNacPTase antibody. RN and RC were assayed at 10, 25, and 50 µg/ml.

 
The NH2-terminal Fragment of Neurocan Inhibits β1-Integrin–mediated Adhesion and Neurite Outgrowth
We have previously demonstrated that binding of the anti-GalNAcPTase antibody 1B11 to chick retina cells results in inhibition of both cadherin- and integrin-mediated adhesion (Gaya-Gonzalez et al. 1991), and our working hypothesis is that neurocan is an endogenous ligand for the cell-surface GalNAcPTase (Balsamo et al. 1995). This led us to determine if the NH2-terminal fragment of neurocan is also active in inhibiting β1-integrin–mediated adhesion and neurite outgrowth. E8 chick retina cells were assayed for adhesion to laminin-coated wells in the presence and absence of the NH2-terminal neurocan fragment. The anti–chick β1 antibody JG22 (Greve and Gottlieb 1982; Tomaselli et al. 1986; Gaya-Gonzalez et al. 1991), and the anti–N-cadherin antibody NCD-2 serve as controls for the extent and specificity of adhesion. NCD-2 has no effect on adhesion to laminin, whereas JG22 maximally inhibits adhesion by ~60% (Fig. 6). This residual adhesion may be a result of nonspecific interactions or the function of nonintegrin laminin receptors (Powell and Kleinman 1997). Like JG22, the NH2-terminal fragment inhibits adhesion to laminin by ~60% at 10 µg/ml, whereas the COOH-terminal fragment has little or no effect (Fig. 6). This suggests that the NH2-terminal fragment inhibits β1-integrin–mediated adhesion by close to 100%. β1-Integrin–mediated neurite outgrowth is similarly affected; the NH2-terminal, but not the COOH-terminal fragment, inhibits neurite extension (Fig. 7 A) with maximal inhibition by the NH2-terminal fragment of ~60% at 10 µg/ml (Fig. 7 B). In agreement with our previous observations (Gaya-Gonzalez et al. 1991), the anti-GalNAcPTase antibody 1B11 inhibits neurite extension on laminin. Thus, interaction of the NH2-terminal fragment of neurocan with cells results in coordinate inhibition of cadherin- and integrin-mediated adhesion and neurite outgrowth.


Figure 6
View larger version (15K):
[in this window]
[in a new window]
[Download PPT slide]
 
Figure 6 The NH2-terminal fragment of neurocan inhibits β1-integrin–mediated adhesion. Single cells from E9 retina were plated on laminin-coated 96-well plates and incubated in the presence of the designated additives. Co, no additives; JG22, anti–β1-integrin antibody; NCD, anti–N-cadherin antibody; RN and RC, neurocan NH2- and COOH-terminal fragments respectively at 10 µg/ml. Adhesion was measured as percent of control.

 

Figure 7
View larger version (46K):
[in this window]
[in a new window]
[Download PPT slide]
 
Figure 7 The NH2-terminal fragment of neurocan inhibits β1-integrin–mediated neurite outgrowth. E7 retina cells were plated on laminin-coated glass coverslips and incubated for 2 h before the addition of anti-integrin antibody JG22, RN, or RC, as described in Fig. 5. (A) Representative fields of each treatment (RN and RC at 20 µg/ml). (B) The number of cells bearing neurites longer than one cell in diameter is expressed as a percentage of the control. 1B11, anti-GalNacPTase antibody; JG22, anti–β1-integrin antibody. RN and RC were assayed at 10 and 25 µg/ml.

 
Neurocan-mediated Inhibition of Cadherin and Integrin Function Is via the GalNAcPTase
Native neurocan core protein binds to the glycophosphatidylinositol-linked cell-surface GalNAcPTase (Balsamo et al. 1995). To determine if recombinant neurocan and its NH2-terminal fragment also bind directly to the GalNAcPTase, cells were incubated with the full-length neurocan, the NH2- and COOH-terminal fragments, followed by the reducible cross-linking reagent DTSSP. After lysis and precipitation with anti-GalNAcPTase antibody, Western transfers of SDS-PAGE were probed with antineurocan antibody that recognizes both fragments. Full-length neurocan and the NH2-terminal fragment, but not the COOH-terminal fragment, are present (Fig. 8), indicating that neurocan interacts with the GalNAcPTase through the NH2 terminus.


Figure 8
View larger version (23K):
[in this window]
[in a new window]
[Download PPT slide]
 
Figure 8 Neurocan and its NH2-terminal fragment bind to the cell-surface GalNAcPTase. Single cells prepared from E9 retinas were incubated with no additives (CO), RN (20 µg/ml), RC (20 µg/ml), or RP (40 µg/ml) for 30 min at 37°C. The cells were treated with the cross-linking reagent DTSSP. Triton X-100 lysates of cells were immunoprecipitated with anti-GalNAcPTase antibody, fractionated by SDS-PAGE, and Western transfers were prepared. RN/0, cross-linking and lysis at 0 time. (top) Immunoblot with antineurocan antibody. (bottom) Immunoblot with anti-GalNAcPTase antibody.

 
The GalNAcPTase is associated with the cell surface through a glycophosphatidylinositide linkage (Balsamo and Lilien 1993). Removal of the GalNAcPTase by treating cells with PI-PLC eliminates the effect of the 250kD PG/neurocan on cadherin-mediated adhesion and neurite outgrowth (Balsamo et al. 1995). Similarly, treatment of E9 chick retina cells with PI-PLC removes the GalNAcPTase (Fig. 9, box at top) and eliminates the effect of neurocan on β1-integrin–mediated neurite outgrowth (Fig. 9).


Figure 9
View larger version (21K):
[in this window]
[in a new window]
[Download PPT slide]
 
Figure 9 Removal of cell-surface GalNAcPTase with PIPLC eliminates the effect of the neurocan NH2-terminal fragment on integrin-mediated neurite outgrowth. E7 retina cells were incubated with or without 5u/ml PIPLC for 30 min at 30°C. The cells were assayed for neurite growth, as described Fig. 7, and for the presence of the GalNAcPTase by immunoblot after SDS-PAGE, Western transfer, and immunoblot (top).

 
We previously suggested that the inhibitory effect of the 250kD PG/neurocan on cadherin function was due to a signal initiated on binding to the GalNAcPTase that results in retention of phosphate on tyrosine residues of β-catenin with concomitant uncoupling of N-cadherin from the actin-containing cytoskeleton (Balsamo et al. 1995). Similarly, treatment of E9 chick retina cells with recombinant neurocan or its NH2-terminal fragment, but not the COOH-terminal fragment, reduces the amount of actin associated with N-cadherin and increases the phosphotyrosine content of β-catenin. Disruption of the cadherin/actin connection and enhancement of the phosphotyrosine content of β-catenin is very rapid, occurring within 5 min after incubation of cells with neurocan and remaining relatively constant through 15 min (Fig. 10). In contrast to the pattern of β-catenin phosphorylation, disassembly of the cadherin–cytoskeletal connection, as measured by coimmunoprecipitation of actin, increases during the first 15 min of incubation with neurocan (Fig. 10, top).


Figure 10
View larger version (36K):
[in this window]
[in a new window]
[Download PPT slide]
 
Figure 10 Treatment of cells with neurocan NH2-terminal fragment results in dissociation of N-cadherin from actin and hyperphosphorylation of β-catenin on tyrosine residues. E9 retina cells were incubated with RN or RC at 37°C for 5 and 15 min. The treated cells were lysed in Triton X-100 and immunoprecipitated with anti–N-cadherin antibody NCD-2. The precipitates were fractionated by SDS-PAGE, and Western transfers were prepared and immunoblotted with antiactin antibody and NCD-2 (top). The resulting supernatants were immunoprecipitated with anti–β-catenin antibody (after treatment with 1% SDS to disrupt protein–protein interactions), fractionated by SDS-PAGE, and immunoblotted with anti-PY antibody. The membranes were stripped and reprobed with anti–β-catenin antibody (bottom). The heavy bands in the top panel marked by an asterisk are IgG heavy chains.

 
The Effect of Neurocan on Integrin-mediated Adhesion Is Mediated by N-Cadherin
Neurocan binds to the GalNAcPTase through its NH2 terminus, initiating a signal that results in the inhibition of N-cadherin– and integrin-mediated adhesion. The signal initiated on binding of neurocan to the GalNAcPTase results in disassembly of the complex of proteins associated with the cytoplasmic domain of N-cadherin (see also Balsamo et al. 1991, Balsamo et al. 1995). Further, the GalNAcPTase is intimately associated with N-cadherin (Balsamo and Lilien 1990), but no association with integrin has been detected (Lilien et al. 1999). Based on these data, we speculated that one or more of the protein effectors, originally associated with the cytoplasmic domain of N-cadherin, may be translocated to the integrin complex where it has an inhibitory effect on integrin-mediated adhesion and neurite outgrowth.

In the companion paper (Arregui et al. 2000), we have used cell permeable peptides coupled to sequences mimicking specific regions of the cytoplasmic domain of N-cadherin to cause the release of effectors from the cadherin complex, and have assayed their effect on N-cadherin and β1-integrin–mediated adhesion. Consistent with the above hypothesis, a cell permeable peptide bearing a sequence mimicking the juxtamembrane region of N-cadherin (JMP) causes the specific release of the nonreceptor tyrosine kinase Fer, normally associated with the cadherin complex of cytoplasmic proteins (Kim and Wong 1995; Rosato et al. 1998), and its translocation to the cytoplasmic complex of proteins associated with β1-integrin with concomitant loss of β1-integrin–mediated adhesion (Arregui et al. 2000). In contrast, treatment of cells with a cell permeable peptide containing a sequence that mimics the β-catenin binding region of N-cadherin (CBP) also causes the release of Fer, but in a complex with β-catenin and p120CAT. Under these circumstances Fer is not translocated to the integrin complex and there is no effect on integrin function (Arregui et al. 2000).

To determine if treatment of cells with recombinant neurocan NH2-terminal fragment also results in translocation of Fer from cadherin to the β1-integrin complex, retina cells were treated with recombinant NH2-terminal neurocan, cell lysates immunoprecipitated with anti–N-cadherin antibody or anti-FAK antibody, and the immunoprecipitates were analyzed for the presence of Fer. Indeed, Fer is lost from the cadherin complex and appears associated with the integrin complex (Fig. 11). Like neurocan, treatment of cells with the anti-GalNAcPTase antibody 1B11, but not 7A2, also results in the loss of N-cadherin and β1-integrin functions and translocation of Fer to the integrin complex (Fig. 11). If translocation of Fer from cadherin to integrin, on treatment of cells with neurocan, is causally related to the loss of integrin function, we speculated that the release of Fer complexed with p120CAT and β-catenin, as occurs when cells are treated with CBP, might eliminate this signal, abolishing the effect of neurocan on integrin-mediated adhesion. To test this idea, we pretreated retina cells for 2 h with CBP, before addition of neurocan. Pretreatment with CBP does in fact abolish the effect of neurocan on β1-integrin–mediated adhesion (Fig. 12). Treatment with the CBP alone or control antennapedia peptide (COP) alone has no effect on integrin-mediated adhesion (Fig. 12). Thus, a specific configuration of proteins associated with the cytoplasmic domain of N-cadherin is essential for neurocan-mediated inhibition of integrin function. Furthermore, translocation of the nonreceptor protein tyrosine kinase Fer from cadherin to integrin appears to be at least one component of a mechanism required for signaling from cadherin to integrin (Arregui et al. 2000).


Figure 11
View larger version (12K):
[in this window]
[in a new window]
[Download PPT slide]
 
Figure 11 Treatment of cells with the neurocan NH2-terminal fragment results in release of the protein tyrosine kinase Fer from the cadherin-associated complex of proteins and its association with the β1-integrin complex. E9 retina cells were treated with 10 µg/ml of recombinant neurocan NH2-terminal fragment (RN) or with anti-GalNAcPTase antibodies 1B11 or 7A2. The cells were lysed in buffer containing nonionic detergent and the lysates were immunoprecipitated with anti-FAK or anti–N-cadherin antibodies. The immunocomplexes were subjected to SDS-PAGE, followed by immunoblotting with the indicated antibodies.

 

Figure 12
View larger version (16K):
[in this window]
[in a new window]
[Download PPT slide]
 
Figure 12 The inhibitory effect of neurocan NH2-terminal fragment on integrin-mediated adhesion is mediated through N-cadherin. E9 retina cells were incubated with 4 µM cell permeable control (COP) or β-catenin–binding (CBP) peptides for 2 h at 4°C. The cells were plated on laminin-coated dishes in the presence or absence of RN (10 µg/ml) and incubated for 2 h at 37°C. Adhesion is expressed as a percentage of the control. COP/N and CBP/N refer to addition of peptide followed by RN.

 
Neurocan and Its Receptor GalNAcPTase Have a Complementary Distribution in the Retina
By affecting both cadherin- and integrin-mediated adhesion and neurite outgrowth, interaction of neurocan with its receptor GalNAcPTase may have profound effects on morphogenesis. To locate regions of the developing neural retina where such interactions might take place, we immunostained retina sections from E7 to E18 with affinity-purified polyclonal antineurocan antibody and anti-GalNAcPTase antibody. By E7, neurocan is expressed in the developing inner plexiform layer (IPL) and continues to be associated with this layer through E18 (Fig. 13) until hatching, when little or no staining is seen (data not shown). Neurocan expression also appears transiently in the nerve fiber layer and the outer plexiform layer between E15 and E18 (Fig. 13). The GalNAcPTase is initially present throughout the retina at E7 (not shown), but becomes progressively concentrated in the ganglion cell layer, the inner nuclear layer, and the nerve fiber layer from about E15 (Fig. 13). This is consistent with previous observations made using other anti-GalNAcPTase antibodies (Balsamo et al. 1986). Thus, during development, neurocan staining in IPL is sandwiched by the GalNAcPTase expression in the ganglion cell and inner nuclear layers. This is most clearly seen in the overlay images (Fig. 13, bottom).


Figure 13
View larger version (28K):
[in this window]
[in a new window]
[Download PPT slide]
 
Figure 13 Expression of neurocan and its receptor GalNAcPTase in the developing retina. Frozen sections of retina tissue at several developmental stages were stained with antineurocan and anti-GalNAcPTase antibody, followed by fluorescence-conjugated secondary antibodies. PH, photoreceptor layer; OPL, outer plexiform layer; INL, inner nuclear layer; IPL, inner plexiform layer; GCL, ganglion cell layer; and NFL, nuclear fiber layer.

 
To identify the cell type(s) expressing neurocan and the GalNAcPTase, E9 retina cells cultured on laminin-coated substrates were stained with antineurocan or anti-GalNAcPTase antibodies. At this time, neurocan is already associated with the IPL, whereas the GalNAcPTase is still very generally distributed throughout the retina. Consistent with the tissue distribution, the GalNAcPTase is associated with the vast majority of cells in culture (not shown), whereas neurocan is strongly present on a minority population of cells with multiple processes (Fig. 14 A). Among this population, neurocan is most strongly associated with these processes (Fig. 14), but also appears to be secreted and bound to the surrounding substrate in some cases (Fig. 14 and Fig. 15).


Figure 14
View larger version (50K):
[in this window]
[in a new window]
[Download PPT slide]
 
Figure 14 Amacrine cells express neurocan. E9 retina cells were cultured overnight before staining with antibodies. A shows the morphology of typical cells expressing neurocan. (B) Cells were double stained with antisyntaxin and antineurocan. Bar, 20 µm.

 

Figure 15
View larger version (49K):
[in this window]
[in a new window]
[Download PPT slide]
 
Figure 15 Typical ganglion cells are not reactive with antineurocan antibody. E9 cells cultured overnight were stained with antineurocan and 8D9, a ganglion cell marker, followed by FITC-conjugated secondary antibody. The arrowheads point to cells showing typical ganglion cell morphology, reactive with 8D9, but not antineurocan. The arrows point to cells reactive with both antibodies, but with atypical ganglion cell morphology. Bar, 20 µm.

 
To further define the cell type on which neurocan appears, a series of antibodies recognizing proteins associated with specific cell types were used in combination with antineurocan antibody. Consistent with the presence of neurocan in the IPL, a marker for amacrine cells, antisyntaxin antibody (HPC-1; Barnstable et al. 1985), labels the same population of cells as antineurocan (Fig. 14 B). Cells that bind antineurocan antibody also express neurocan mRNA, which is concentrated in the cell bodies (not shown). Neither a bipolar cell-specific antibody 3G3 (Burden-Gulley and Brady-Kalnay 1999; Lemmon, V., personal communication), or a glial cell marker, 3A7 (Lemmon 1985) recognize this population (not shown). Consistent with the morphological characteristics of the neurocan-positive cells, cells with one, unidirectional, long neurite, which are reactive with the ganglion cell-specific antibody, 8D9 (Lemmon and McLoon 1986), do not react with antineurocan antibody (Fig. 15). However, there is a population of cells with short, multiple neurites that are reactive with both 8D9 and antineurocan (Fig. 15).


   Discussion
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Coordinate Regulation of Cadherin and Integrin
We have isolated the complete cDNA for chicken neurocan, and demonstrate that recombinant fusion protein, like the purified native proteoglycan, is active in inhibiting both N-cadherin– and β1-integrin–mediated cell adhesion and neurite outgrowth. Coordinate regulation appears to be mediated through the interaction of neurocan with its receptor GalNAcPTase. Native neurocan (Balsamo et al. 1995) and recombinant protein, as well as the smallest active fragment, the NH2 terminus containing the Ig loop and the HA-binding domain, all bind to the cell-surface GalNAcPTase. Furthermore, removal of the GalNAcPTase with PI-PLC abolishes the inhibitory effect on both adhesion systems. Further dissection of the NH2 terminus into the Ig loop alone, the HA domain alone, or the Ig loop with a fragment of the HA binding results in a loss of activity. The requirement for the HA binding domain is consistent with our previous observation that aggregates containing the 250kD PG with HA are inactive (Balsamo et al. 1995); both sets of data suggest that the exposed HA-binding domain is essential for functional interaction with the GalNAcPTase.

In Fig. 16, we have attempted to pictorially represent the interactions taking place on binding of neurocan to its GalNAcPTase receptor. Loss of cadherin function is correlated with uncoupling from the cytoskeleton after hyperphosphorylation and release of β-catenin from its association with cadherin (Balsamo et al. 1995). Hyperphosphorylation of β-catenin has consistently been correlated with the loss of adhesive function (Daniel and Reynolds 1997; Lilien et al. 1997). Our laboratory has demonstrated that the nonreceptor protein tyrosine phosphatase PTP1B regulates β-catenin phosphorylation (Balsamo et al. 1995, Balsamo et al. 1996, Balsamo et al. 1998). PTP1B binds to the cytoplasmic domain of N-cadherin and is essential for the continued removal of phosphate from tyrosine residues of β-catenin (Balsamo et al. 1998). Furthermore, phosphorylation of PTP1B is essential for binding to cadherin (Balsamo et al. 1996, Balsamo et al. 1998). Neurocan–GalNAcPTase interaction results in inactivation or loss of protein tyrosine kinase activity from the cadherin complex. This appears to initiate a cascade resulting in the loss of PTP1B, retention of phosphate groups on tyrosine residues of β-catenin and uncoupling of cadherin from the actin cytoskeleton (Balsamo et al. 1995, Balsamo et al. 1996, Balsamo et al. 1998). Based on the data presented in this paper and Arregui et al. 2000, the protein tyrosine kinase may be the nonreceptor tyrosine kinase Fer. Disassembly of the cadherin complex of proteins and the cytoskeletal connection on interaction of neurocan with its receptor may also be accompanied by loss of cadherin dimers, which is the functional unit required for strong adhesion (Yap et al. 1997; Takeda et al. 1999).


Figure 16
View larger version (22K):
[in this window]
[in a new window]
[Download PPT slide]
 
Figure 16 Pictorial representation of the known protein interactions in the cadherin and integrin complex potentially altered on binding of neurocan to its receptor GalNAcPTase. On the right is a functional cadherin complex showing the known protein interactions. The interaction of β-catenin, p120ctn, and Fer is based on Arregui et al. 2000. On the left, after binding of neurocan, are the alterations induced in the cadherin complex rendering it nonfunctional and potential Fer targets in the integrin complex.

 
Our data are consistent with inhibition of integrin function by neurocan being dependent on a signal generated through cadherin. We base this on three lines of evidence. First, we demonstrate that the interaction of neurocan with the GalNAcPTase results in translocation of Fer from its association with the cytoplasmic domain of cadherin (Kim and Wong 1995; Rosato et al. 1998) to the integrin complex of proteins. This is consistent with the fact that overexpression of Fer inhibits integrin-mediated adhesion (Rosato et al. 1998). Additionally, we have shown (Arregui et al. 2000) that inducing the release of Fer from the cadherin complex using a cell permeable peptide containing a sequence mimicking the juxtamembrane region of cadherin results in its translocation to the integrin complex and loss of integrin function. Second, release of a complex of proteins containing β-catenin, p120CAT, and Fer from the cytoplasmic domain of cadherin before treatment of cells with neurocan abolishes the effect of neurocan on integrin function (this article and Arregui et al. 2000). This suggests that a specific array of effectors must be associated with the cadherin complex for transduction of the neurocan-induced signal regulating integrin function to occur. Third, cadherins, N and E (Balsamo and Lilien 1990; Bauer et al. 1992), but not β1-integrins (Lilien et al. 1999) are intimately associated with the GPI-anchored, neurocan receptor GalNAcPTase, suggesting that the neurocan-induced signal is mediated by cadherin. There are a number of GPI-linked proteins that act as coreceptors in the sense that the signal is transduced through a transmembrane partner. Perhaps the most interesting, for our purposes, is the association of the receptor tyrosine kinase Ret with GPI-linked coreceptors. Ret has two extracellular cadherin-like repeats (Iwamoto et al. 1993) and associates with two GPI-linked coreceptors. Binding of the ligand to its GPI-linked coreceptors activates Ret phosphorylation setting the appropriate signaling pathway in motion (Jing et al. 1996; Treanor et al. 1996; Buj-Bello et al. 1997; Klein et al. 1997).

Loss of integrin function, either through overexpression of Fer (Rosato et al. 1998) or through perturbation with a cell permeable peptide mimicking the juxtamembrane region of cadherin (Arregui et al. 2000) is correlated with hypophosphorylation of p130cas, as is the inability to assemble focal adhesions (Nojima et al. 1995; Petch et al. 1995; Vuori and Ruoslahti 1995). p130cas interacts directly with the tyrosine phosphatases PTP-PEST (Garton et al. 1997) and PTP1B (Liu et al. 1996), as well as the tyrosine kinase FAK (Polte and Hanks 1995). It has been suggested that these components compete with each other to regulate the tyrosine phosphorylation of p130cas and, therefore, assembly of focal adhesions (Garton et al. 1997). Tyrosine-phosphorylated p130cas also interacts with Crk (Matsuda and Kurata 1996), and this interaction has the potential to protect p130cas from dephosphorylation (Birge et al. 1992). The most conservative explanation for the hypophosphorylation of p130cas on interaction of Fer with the integrin complex is that Fer affects one or more of p130cas' binding partners, PTP-PEST, PTP1B, FAK or even Crk, altering their activity, or their interaction with p130cas, changing the balance of phosphorylated tyrosine residues and, thus, integrin function.

Neurocan's Modular Organization Allows Interactions with Many Adhesion-related Molecules
Neurocan is a member of a family of structurally similar chondroitin sulfate proteoglycans (Margolis and Margolis 1994) including aggrecan (Doege et al. 1987), versican (Zimmermann and Ruoslahti 1989), and brevican (Yamada et al. 1994; Jaworski et al. 1995). The family has been referred to as lecticans (Ruoslahti 1996) or hyalectans (Iozzo 1998). All members of the family have a similar modular organization, a conserved Ig-loop and hyaluronic acid (HA)–binding motifs at the NH2 terminus, and EGF-like, lectin-like and complement regulatory-like domains on the COOH terminus. The structure of this family appears as two globular domains separated by a linear domain containing the majority of the chondroitin sulfate chains (Retzler et al. 1996b).

Sequence comparisons of neurocan from rat (Rauch et al. 1992), mouse (Rauch et al. 1995), human (Prange et al. 1998), and now chicken, reveal that these NH2- and COOH-terminal domains are highly conserved (Fig. 1 A). However, the central elongate region shows little or no conservation. These data suggest that each of the NH2- and COOH-terminal domains has specific functions, while the functional role(s) of the central portion requires only conservation of minimal sequence motifs essential for glycosylation.

Both the sugar side chains and the polypeptide backbone of neurocan interact with adhesion-related molecules. NCAM and NgCAM interact with neurocan through the chondroitin sulfate chains (Friedlander et al. 1994) and both intact neurocan and neurocan-C, a naturally occurring COOH-terminal fragment with a 150-kD core protein (Oohira et al. 1994), are able to inhibit homophilic binding of NCAM (Retzler et al. 1996a). Additionally, neurocan inhibits neurite extension by neurons that express NCAM and NgCAM, presumably by interacting directly with these cell adhesion molecules to disrupt homophilic interactions (Grumet et al. 1993, Grumet et al. 1996; Friedlander et al. 1994). In contrast, the Ig superfamily adhesion molecule TAG-1/axonin-1 interacts with the neurocan core protein (Milev et al. 1996). The physiological significance of these interactions is supported by the overlapping distribution of these adhesion molecules with neurocan in embryonic and early postnatal nervous tissue (Milev et al. 1996).

The COOH terminus of the neurocan polypeptide interacts with the extracellular matrix protein tenascin-C (Rauch 1997). The COOH-terminal lectinlike domain of brevican binds cell-surface glycolipids and promotes cell adhesion (Miura et al. 1999), suggesting a similar function for the neurocan lectinlike domain. Additionally, the COOH terminus of several family members can bind simple sugars (Halberg et al. 1988; Saleque et al. 1993; Ujita et al. 1994), suggesting lectin-like interactions.

Our data add to the group of adhesion-related molecules that interact with neurocan and further indicate a specific role for the NH2 terminus containing the Ig loop and the HA-binding domain in regulating cadherin and integrin function. The predominant expression of neurocan in the central nervous system (Oohira et al. 1994; Meyer-Puttlitz et al. 1995; Fukuda et al. 1997; Matsui et al. 1998) and its multiple interactions through distinct domains with adhesion-related molecules suggests that neurocan has evolved as an modular extracellular regulator of cell–cell and cell–matrix interactions that guide the cellular rearrangements essential to the formation and function of the nervous system.

Neurocan May Act as a Barrier to Neurite Extension in the Developing Retina
In the developing retina, neurocan expression predominates in the IPL, but is also transiently associated with the outer plexiform layer (OPL), whereas the GalNAcPTase, which was originally distributed to most layers in the retina, becomes restricted to the ganglion cell layer and inner nuclear layer, sandwiching the IPL. Consistent with this distribution, we find that, in vitro, it is amacrine cells with multiple processes that express and synthesize neurocan and deposit it on the substrate around cell bodies and processes.

There are two possible exceptions to this cellular distribution. First, we occasionally observe that neurocan and the amacrine cell marker HPC-1 do not overlap. This may be explained by the number of different subtypes of amacrine cells, some expressing neurocan and others not, but all being HPC-1–positive. Alternatively, HPC-1 also weakly reacts with some horizontal cells (Gleason et al. 1993), and it is possible that, in our culture system, some HPC-1–positive cells are horizontal cells, not expressing neurocan. We do observe transient neurocan staining in the OPL at around day 14, and this may be due to transient expression by horizontal cells. Second, some neurocan-positive cells with typical stellate morphology are positive for the ganglion cell marker, 8D9. It is likely that these cells are not ganglion cells. In fact, it has been shown that 8D9 does stain the IPL faintly. This may be due to either ganglion cell dendrites or processes of amacrine cells (Lemmon and McLoon 1986). Our finding that amacrine cells express neurocan favors the latter possibility; however, we cannot exclude the possibility that some ganglion cells may also express neurocan.

The ability of neurocan to affect the function of many distinct adhesion molecules either directly or indirectly suggests that its spatiotemporal distribution may play critical roles in morphogenesis of the retina. While much is known about the distribution of adhesion molecules in the developing retina and some functional analyses have been performed using antibodies (Buskirk et al. 1980; Hoffman et al. 1986; Matsununga et al. 1988; Svennevik and Linser 1993; Stone and Sakaguchi 1996) and by introducing dominant negative constructs into the developing Xenopus eye (Lilienbaum et al. 1995; Riehl et al. 1996), the role of endogenous modifiers of adhesion molecule function, such as neurocan, has not been explored experimentally. Chondroitin sulfate proteoglycans have been shown to act as a barrier to neurite extension in general (Faissner and Steindler 1995; Margolis and Margolis 1997) and have been suggested to influence the direction of retinal ganglion cell outgrowth (Snow et al. 1991). The expression of neurocan juxtaposed by its receptor, GalNAcPTase, does indeed suggest a role for this interacting pair in restricting cell or process movement mediated by cadherin and/or integrin at such boundaries. Furthermore, because of its interactions with other adhesion molecules in the immunoglobulin superfamily, neurocan is well suited to such a role in the retina. Thus neurocan, and possibly other chondroitin sulfate proteoglycans, may act to prevent ganglion cell projections from extending to other layers of the retina, orienting them to form the nerve fiber layer. Indeed, retinal neurons extend processes in vitro mediated by cadherin, integrin and NCAM (Neugebauer et al. 1988), and purified neurocan acts as barrier to neurite extension by retina neurons in vitro (Balsamo et al. 1996).


   Acknowledgments
 
This study was supported by grants from the National Science Foundation (No. 95-13325 to J. Lilien) and the National Institutes of Health (No. EY12132 to J. Lilien and No. HL37641 to S. Hoffman).

Submitted: 10 February 2000

Revised: 11 April 2000

Accepted: 4 May 2000

The present address of H. Li is Neuroscience Center, Nelson Biological Laboratories, 604 Allison Road, Rutgers University, Piscataway, NJ 08854-8082. The present address of T.C. Leung is Department of Developmental Biology, Institute Biology I, University of Freiburg, Hauptstrasse 1, D-79104 Freiburg, Germany. The present address of J. Balsamo and J. Lilien is Department of Biological Sciences, University of Iowa, Iowa City, IA 52242-1324.

Abbreviations used in this paper: 250kD PG, 250-kD chondroitin sulfate proteoglycan; CBP, catenin binding peptide; COP, control antennapedia peptide; GalNAcPTase, cell-surface glycosyltransferase; HA, hyaluronic acid; IPL, inner plexiform layer; JMP, juxtamembrane peptide; OPL, outer plexiform layer.


   References
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 

Arregui C., Balsamo J. & Lilien J.. Impaired integrin-mediated adhesion and signaling in fibroblasts expressing a dominant negative mutant PTP1B, J. Cell Biol., 143, 1999, 861–873.[Medline]

Arregui C., Pathre P., Lilien J. & Balsamo J.. The nonreceptor tyrosine kinase Fer mediates cross-talk between N-cadherin and β1-integrin, J. Cell Biol., 149, 2000, 1263–1273.[Abstract/Free Full Text]

Balsamo J. & Lilien J.. N-cadherin is stably associated with, and is an acceptor for, a cell surface N-acetylgalactosaminylphosphotransferase, J. Biol. Chem., 265, 1990, 2923–2928.[Abstract/Free Full Text]

Balsamo J. & Lilien J.. The retina cell-surface N-acetylgalactosaminylphosphotransferase is anchored by a glycophosphatidylinositol, Biochemistry., 32, 1993, 8246–8250.[Medline]

Balsamo J., Hoffman S. & Lilien J.. Control of cadherin-mediated cell-cell adhesion through regulated association with the cytoskeleton, J. Braz. Assoc. Adv. Sci., 48, 1996, 341–346.

Balsamo J., Pratt R.S., Emmerling M.R., Grunwald G. & Lilien J.. Identification of the chick neural retina cell surface N-acetylgalactosaminyltransferase using monoclonal antibodies, J. Cell Biochem., 32, 1986, 125–141.[Medline]

Balsamo J., Thiboldeaux R., Swaminathan N. & Lilien J.. Antibodies to the retina N-acetylgalactosaminylphosphotransferase modulate N-cadherin–mediated adhesion and uncouple the N-cadherin transferase complex from the actin-containing cytoskeleton, J. Cell Biol., 113, 1991, 429–436.[Abstract/Free Full Text]

Balsamo J., Ernst H., Zanin M.K., Hoffman S. & Lilien J.. The interaction of the retina cell surface N-acetylgalactosaminylphosphotransferase with an endogenous proteoglycan ligand results in inhibition of cadherin-mediated adhesion, J. Cell Biol., 129, 1995, 1391–1401.[Abstract/Free Full Text]

Balsamo J., Leung T.-C., Ernst H., Zanin M.K., Hoffman S. & Lilien J.. Regulated binding of a PTP1B-like phosphatase to N-cadherincontrol of cadherin-mediated adhesion by dephosphorylation of β-catenin, J. Cell Biol., 134, 1996, 801–813.[Abstract/Free Full Text]

Balsamo J., Arregui C., Leung T.-C. & Lilien J.. The nonreceptor protein tyrosine phosphatase PTP1B binds to the cytoplasmic domain of N-cadherin and regulates the cadherin-actin linkage, J. Cell Biol., 143, 1998, 523–532.[Abstract/Free Full Text]

Barnstable C.J., Hofstein R. & Akagawa K.. A marker for early amacrine cell developement in rat retina, Brain Res., 325, 1985, 286–290.[Medline]

Bauer G.E., Balsamo J. & Lilien J.. Cadherin-mediated adhesion in pancreatic islet cells is modulated by a cell surface N-acetylgalactosaminylphosphotransferase, J. Cell. Sci., 103, 1992, 1235–1241.[Abstract/Free Full Text]

Bause E.. Structural requirements of N-glycosylation of proteins. Studies with proline peptides as conformational probes, Biochem. J., 209, 1983, 331–336.[Medline]

Birge B., Fagardo J., Mayer B. & Hanafusa H.. Tyrosine phosphorylated epidermal growth factor receptor and p130 provide high affinity binding substrates to analyze Crk-phosphotyrosine-dependent interactions in vitro, J. Biol. Chem., 267, 1992, 10588–10595.[Abstract/Free Full Text]

Bixby J.L., Lilien J. & Reichardt L.F.. Identification of the major proteins that promote neuronal process outgrowth on Schwann cells in vitro, J. Cell Biol., 107, 1988, 355–361.

Bourdon M.A., Krusius T., Campbell S., Schwartz N.B. & Ruoslahti E.. Identification and synthesis of a recognition signal for the attachment of glycosaminoglycans to proteins, Proc. Natl. Acad. Sci. USA., 84, 1987, 3194–3198.[Abstract/Free Full Text]

Buj-Bello A., Adu J., Pinon L.G.P., Horton A., Thompson J., Rosenthal A., Chinchetru M., Buchman V.L. & Davis A.M.. Neurturin responsiveness requires a GPI-linked receptor and the Ret receptor tyrosine kinase, Nature., 387, 1997, 721–724.[Medline]

Burden-Gulley S.M. & Brady-Kalnay S.M.. PTPµ regulates N-cadherin–dependent neurite outgrowth, J. Cell Biol., 144, 1999, 1323–1336.[Abstract/Free Full Text]

Buskirk D.R., Thiery J.P., Rutishauser U. & Edelman G.M.. Antibodies to neural cell adhesion molecule disrupt histogenesis in cultured chick retinae, Nature., 285, 1980, 488–489.[Medline]

Daniel J.M. & Reynolds A.B.. Tyrosine phosphorylation and cadherin/catenin function, Bioessays., 19, 1997, 883–891.[Medline]

Derossi D., Joliot A.H., Chassaing G. & Prochiantz A.. The third helix of the antennapedia homeodomain translocates through biological membranes, J. Biol. Chem., 269, 1994, 10444–10450.[Abstract/Free Full Text]

Doege K., Sasaki M., Horigan E., Hassell J.R. & Yamada Y.. Complete primary structure of the rat cartilage proteoglycan core protein deduced from cDNA clones, J. Biol. Chem., 262, 1987, 17757–17767.[Abstract/Free Full Text]

Faissner A. & Steindler D.. Boundaries and inhibitory molecules in developing neural tissues, Glia., 13, 1995, 233–254.[Medline]

Friedlander D.R., Milev P., Karthikeyan L., Margolis R.K., Margolis R.U. & Grumet M.. The neuronal chondroitin sulfate proteoglycan neurocan binds to the neural cell adhesion molecules Ng-CAM/L1/NILE and N-CAM, and inhibits neuronal adhesion and neurite outgrowth, J. Cell Biol., 125, 1994, 669–680.[Abstract/Free Full Text]

Fukuda T., Kawano H., Ohyama K., Li H.P., Takeda Y., Oohira A. & Kawamura K.. Immunohistochemical localization of neurocan and L1 in the formation of thalamocortical pathway of developing rats, J. Comp. Neurol., 382, 1997, 141–152.[Medline]

Garton A.J., Burnbaum M.R., Bouton A.H. & Tonks N.K.. Association of PTP-PEST with the SH3 domain of p130casa novel mechanism of protein tyrosine phosphatase substrate recognition, Oncogene., 15, 1997, 877–885.[Medline]

Gaya-Gonzalez L., Balsamo J., Swaminathan N. & Lilien J.. Antibodies to the retina N-acetylgalactosaminylphosphotransferase inhibit neurite outgrowth, J. Neurosci. Res., 29, 1991, 474–480.[Medline]

Gleason E., Borges S. & Wilson M.. Synaptic transmission between pairs of retinal amacrine cells in culture, J. Neurosci., 13, 1993, 2359–2370.[Abstract]

Goodman C.S. & Tessier-Lavigne M.. Molecular mechanisms of axon guidance and target recognition, Cowan W.M., Jessel T.M. & Zipursky S.L., Molecular and Cellular Approaches to Neural Development, 1997, 108–178, Oxford University Press, New York.

Greve J.M. & Gottlieb D.I.. Monoclonal antibodies which alter the morphology of cultured chick myogenic cells, J. Cell. Biochem., 18, 1982, 221–229.[Medline]

Grumet M., Flaccus A. & Margolis R.U.. Functional characterization of chondroitin sulfate proteoglycans of braininteractions with neurons and neural cell adhesion molecules, J. Cell Biol., 120, 1993, 815–824.[Abstract/Free Full Text]

Grumet M., Friedlander D.R. & Sakurai T.. Functions of brain chondroitin sulfate proteoglycans during developmentinteractions with adhesion molecules, Perspect. Dev. Neurobiol., 3, 1996, 319–330.[Medline]

Halberg D.F., Proulx G., Doege K., Yamada Y. & Drickamer K.. A segment of the cartilage proteoglycan core protein has lectin-like activity, J. Biol. Chem., 263, 1988, 9486–9490.[Abstract/Free Full Text]

Hatta K. & Takeichi M.. Expression of N-cadherin adhesion molecules associated with early morphogenetic events in chick development, Nature., 320, 1986, 447–449.[Medline]

Hoffman S., Friedlander D.R., Chuong C.-M., Grumet M. & Edelman G.M.. Differential contributions of Ng-CAM and N-CAM to cell adhesion in different neural regions, J. Cell Biol., 103, 1986, 145–158.[Abstract/Free Full Text]

Iozzo R.V.. Matrix proteoglycansfrom molecular design to cellular function, Annu. Rev. Biochem., 67, 1998, 609–652.[Medline]

Iwamoto T., Taniguchi N., Asai N., Ohkusin K., Nakashima I. & Takahashi M.. cDNA cloning of mouse ret proto-oncogene and its sequence similarity to the cadherin superfamily, Oncogene., 8, 1993, 1087–1091.[Medline]

Jing S., Wen D., Yu Y., Holst P.L., Luo Y., Fang M., Tamir R., Antonio L., Hu Z. & Cupples R.. GDNF-induced activation of the ret protein tyrosine kinase is mediated by GDNFR-{alpha}, a novel receptor for GDNF, Cell., 85, 1996, 1113–1124.[Medline]

Jaworski D.M., Kelly G.M. & Hockfield S.. BEHAB, a member of the proteoglycan tandem repeat family of hyaluronan-binding proteins that is restricted to the brain, J. Cell Biol., 125, 1995, 495–509.[Medline]

Kim L. & Wong T.W.. The cytoplasmic tyrosine kinase FER is associated with the catenin-like substrate pp120 and is activated by growth factors, Mol. Cell. Biol., 15, 1995, 4553–4561.[Abstract]

Klein R.D., Sherman D., Ho W.-H., Stone D., Bennett G.L., Moffat B., Vandlen R., Simmons L., Gu Q. & Hongo J.-A.. A GPI-linked protein that interacts with Ret to form a candidate neurturin receptor, Nature., 387, 1997, 717–721.[Medline]

Kreuger R.C. Jr., Fields T.A., Hildreth J. IV & Schwartz N.B.. Chick cartilage chondroitin sulfate proteoglycan core protein I. Generation and characterization of peptides and specificity for glycosaminoglycan attachment, J. Biol. Chem., 265, 1990, 12075–12087.[Abstract/Free Full Text]

Lemmon V.. Monoclonal antibodies specific for glia in the chick nervous system, Brain Res., 355, 1985, 111–120.[Medline]

Lemmon V. & McLoon S.C.. The appearance of an L1-like molecule in the chick visual pathway, J. Neurosci., 6, 1986, 2987–2994.[Abstract]

Lilien J., Balsamo J., Hoffman S. & Eisenberg C.. β-Catenin is a target for extracellular signals controlling cadherin functionthe neurocan-GalNAcPTase connection, Curr. Top. Dev. Biol., 35, 1997, 161–189.[Medline]

Lilien J., Arregui C., Li H. & Balsamo J.. The juxtamembrane domain of cadherin regulates integrin-mediated adhesion and neurite outgrowth, J. Neurosci. Res., 58, 1999, 727–734.[Medline]

Lilienbaum A., Reszka A.A., Horwitz A.F. & Holt C.E.. Chimeric integrins expressed in retinal ganglion cells impairs process outgrowth in vivo, Mol. Cell. Neurosci., 6, 1995, 139–152.[Medline]

Liu F., Hill D.E. & Chernoff J.. Direct binding of the proline-rich region pf protein tyrosine phosphatase 1B to the Src homology 3 domain of p130cas, J. Biol. Chem., 271, 1996, 31290–31295.[Abstract/Free Full Text]

Margolis R.U. & Margolis R.K.. Aggrecan-versican-neurocan family proteoglycans, Methods Enzymol., 245, 1994, 105–126.[Medline]

Margolis R.U. & Margolis R.K.. Chondroitin sulfate proteoglycans as mediators of axon growth and pathfinding, Cell Tissue Res., 290, 1997, 343–348.[Medline]

Matsuda M. & Kurata T.. Emerging components of the Crk oncogene productthe first identified adaptor protein, Cell Signal., 8, 1996, 335–340.[Medline]

Matsui F., Nishizuka M., Yasuda Y., Aono S., Watanabe E. & Oohira A.. Occurrence of a N-terminal proteolytic fragment of neurocan, not a C-terminal half, in a perineuronal net in the adult rat cerebrum, Brain Res., 790, 1998, 45–51.[Medline]

Matsununga M., Hatta K. & Takeichi M.. Role of N-cadherin cell adhesion molecules in the histogenesis of neural retina, Neuron., 1, 1988, 289–295.[Medline]

Meyer-Puttlitz B., Milev P., Junker E., Zimmer I., Margolis R.U. & Margolis R.K.. Chondroitin sulfate and chondroitin/keratan sulfate proteoglycans of nervous tissuedevelopmental changes of neurocan and phosphocan, J. Neurochem., 65, 1995, 2327–2337.[Medline]

Milev P., Maurel P., Haring M., Margolis R.K. & Margolis R.U.. TAG-1/axonin-1 is a high-affinity ligand of neurocan, phosphocan/protein-tyrosine phosphatase-zeta/beta, and N-CAM, J. Biol. Chem., 271, 1996, 15716–15723.[Abstract/Free Full Text]

Miura R., Aspberg A., Ethell I.M., Hagihara K., Schnaar R.L., Ruoslahti E. & Yamaguchi Y.. The proteoglycan lectin domain binds sulfated cell surface glycolipids and promotes cell adhesion, J. Biol. Chem., 274, 1999, 11431–11438.[Abstract/Free Full Text]

Mueller B.K.. Growth cone guidancefirst steps towards a deeper understanding, Annu. Rev. Neurosci., 22, 1999, 351–388.[Medline]

Neugebauer K.M., Tomaselli K.J., Lilien J. & Reichardt L.R.. N-cadherin, NCAM, and integrins promote retinal neurite outgrowth on astrocytes in vitro, J. Cell Biol., 107, 1988, 1177–1187.[Abstract/Free Full Text]

Nojima Y., Morino N., Mimura T., Hamasaki K., Furuya H., Sakai R., Sato T., Tachibana K., Morimoto C., Yazaki Y. & Hirai H.. Integrin-mediated cell adhesion promotes tyrosine phosphorylation of p130cas, a Src-homology 3-containing molecule having multiple Src homology 2-binding motifs, J. Biol. Chem., 270, 1995, 15398–15402.[Abstract/Free Full Text]

Oohira A., Matsui F., Watanabe E., Kushima Y. & Maeda N.. Developmentally regulated expression of a brain specific species of chondroitin sulfate proteoglycan, neurocan, identified with a monoclonal antibody IG2 in the rat cerebrum, Neuroscience., 60, 1994, 145–157.[Medline]

Perez F., Joliot A., Bloch-Gallego E., Zahroui A., Triller A. & Prochiantz A.. Antennapedia homeobox as a signal for the cellular internalization and nuclear addressing of a small exogenous peptide, J. Cell. Sci., 102, 1992, 717–722.[Abstract/Free Full Text]

Petch L.A., Bockholt S.M., Bouton A., Parsons J.T. & Burridge K.. Adhesion induced tyrosine phosphorylation of the p130 src substrate, J. Cell. Sci., 108, 1995, 1371–1379.[Abstract]

Polte T.R. & Hanks S.K.. Interaction between focal adhesion kinase and Crk-associated tyrosine kinase substrate p130cas, Proc. Natl. Acad. Sci. USA., 92, 1995, 10678–10682.[Abstract/Free Full Text]

Powell S.K. & Kleinman H.K.. Neuronal laminins and their cellular receptors, Int. J. Biochem. Cell Biol., 29, 1997, 401–414.[Medline]

Prange C.K., Pennacchio L.A., Lieuallen K., Fan W. & Lennon G.G.. Characterization of the human neurocan gene, CSPG3, Gene., 221, 1998, 199–205.[Medline]

Prochiantz A.. Getting hydrophilic compounds into cellslessons from homeopeptides, Curr. Opin. Neurobiol., 6, 1996, 629–634.[Medline]

Rauch U.. Modeling an extracellular environment for axonal pathfinding and fasciculation in the central nervous system, Cell Tissue Res., 290, 1997, 349–356.[Medline]

Rauch U., Karthikeyan L., Maurel P., Margolis R.U. & Margolis R.K.. Cloning and primary structure of neurocan, a developmentally regulated, aggregating chondroitin sulfate proteoglycan of brain, J. Biol. Chem., 267, 1992, 19536–19547.[Abstract/Free Full Text]

Rauch U., Grimpe B., Kulbe G., Arnold-Ammer I., Beier D.R. & Fassler R.. Structure and chromosomal localization of the mouse neurocan gene, Genomics., 28, 1995, 405–410.[Medline]

Retzler C., Gohring W. & Rauch U.. Analysis of neurocan structures interacting with the neural cell adhesion molecule N-CAM, J. Biol. Chem., 271, 1996, 27304–27310a.[Abstract/Free Full Text]

Retzler C., Wiedemann H., Kulbe G. & Rauch U.. Structural and electron microscopic analysis of neurocan and recombinant neurocan fragments, J. Biol. Chem., 271, 1996, 17107–17113b.[Abstract/Free Full Text]

Riehl R., Johnson K., Bradley R., Grunwald G.B., Cornel E., Lilienbaum A. & Holt C.E.. Cadherin function is required for axon outgrowth in retinal ganglion cells in vivo, Neuron., 17, 1996, 837–848.[Medline]

Rosato R., Veltmaat J.M., Groffen J. & Heistrekamp N.. Involvement of the tyrosine kinase Fer in cell adhesion, Mol. Cell. Biol., 18, 1998, 5762–5770.[Abstract/Free Full Text]

Ruoslahti E.. Brain extracellular matrix, Glycobiology., 6, 1996, 489–492.[Abstract/Free Full Text]

Saleque S., Ruiz N. & Drickamer K.. Expression and characterization of a carbohydrate-binding fragment of rat aggrecan, Glycobiology., 3, 1993, 185–210.[Abstract/Free Full Text]

Schwartz N.B., Pirok E.W. III, Mensch J.R. Jr. & Domowicz M.S.. Domain organization, genomic structure, evolution, and regulation of expression of the aggrecan gene family, Prog. Nucleic Acid Res. Mol. Biol., 62, 1999, 177–225.[Medline]

Scott L.J., Balsamo J., Sanes J.R. & Lilien J.. Synaptic localization and neural regulation of an N-acetylgalactosaminyltransferase in skeletal muscle, J. Neurosci., 10, 1990, 346–350.[Abstract]

Snow D.M., Watanabe W., Letourneau P.C. & Silver J.. A chondroitin sulfate proteoglycan may influence the direction of retinal ganglion cell outgrowth, Development., 113, 1991, 1473–1485.[Abstract]

Song H.-J. & Poo M.-M.. Signal transduction underlying growth cone guidance by diffusible factors, Curr. Opin. Neurobiol., 9, 1999, 355–363.[Medline]

Stone K.E. & Sakaguchi D.S.. Perturbation of the developing Xenopus retinotectal projection following injections of antibodies against β1-integrin receptors and N-cadherin, Develop. Biol., 180, 1996, 297–310.[Medline]

Svennevik E. & Linser P.J.. The inhibitory effects of integrin antibodies and the RGD tripeptide on early eye development, Invest. Ophth. Vis. Sci., 34, 1993, 1774–1784.[Abstract/Free Full Text]

Takeda H., Shimoyama Y., Nagafuchi A. & Hirohashi S.. E-cadherin functions as a cis-dimer at the cell-cell adhesive interface in vivo, Nat. Struct. Biol., 6, 1999, 310–312.[Medline]

Tomaselli K.J., Reichardt L.F. & Bixby J.L.. Distinct molecular interactions mediate process outgrowth on nonneuronal cell surfaces and extracellular matrices, J. Cell Biol., 106, 1986, 2659–2672.[Medline]

Tomaselli K.J., Neugebauer K.M., Bixby J.L., Lilien J. & Reichardt L.F.. N-cadherin and integrinstwo receptor systems that mediate neuronal process outgrowth on astrocyte surfaces, Neuron., 1, 1989, 33–43.

Treanor J.J.S., Goodman L., de Sauvage F., Stone D.M., Poulsen K.T., Beck C.D., Gray C., Armanini M.P., Pollock R.A. & Hefti F.. Characterization of a multicomponent receptor for GDNF, Nature., 382, 1996, 80–83.[Medline]

Ujita M., Shinomura T., Ito K., Kitagawa Y. & Kimata K.. Expression and binding activity of the carboxyl-terminal portion of the core protein of PG-M, a large chondroitin sulfate proteoglycan, J. Biol. Chem., 269, 1994, 27603–27609.[Abstract/Free Full Text]

Vuori K. & Ruoslahti E.. Tyrosine phosphorylation of p130cas and cortactin accompanies integrin-mediated cell adhesion to extracellular matrix, J. Biol. Chem., 270, 1995, 22257–22262.

Yamada H., Watanabe K., Shimonaka M. & Yamaguchi Y.. Molecular cloning of brevican, a novel brain proteoglycan of the aggrecan/versican family, J. Biol. Chem., 269, 1994, 10119–10126.[Abstract/Free Full Text]

Yap A.S., Brieher W.M., Pruschy M. & Gumbiner B.M.. Lateral clustering of the adhesive ectodomaina fundamental determinant of cadherin function, Curr. Biol., 7, 1997, 308–315.[Medline]

Zanin M.K.B., Bundy J., Ernst H., Wessels A., Conway J.S. & Hoffman S.. Distinct spatial and temporal distributions of aggrecan and versican in the embryonic chick heart, Anat. Rec., 256, 1999, 366–380.[Medline]

Zeiner M. & Gehring U.. Cloning of 5' cDNA regions by inverse PCR, Biotechnology., 17, 1994, 1050–1052.

Zimmermann D.R. & Ruoslahti E.. Multiple domains of the large fibroblast proteoglycan, versican, EMBO. (Eur. Mol. Biol. Organ.) J., 8, 1989, 2975–2981.[Medline]


Add to CiteULike CiteULike   Add to Complore Complore   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us   Add to Digg Digg   Add to Facebook Facebook   Add to Reddit Reddit   Add to Technorati Technorati   Add to Twitter Twitter    What's this?

Related Article


J. Cell Biol. 2000 149: 1-2. [Full Text] [PDF]



This article has been cited by other articles:


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF, 645K)
Right arrow PPT slides of all figures
Right arrow Alert me when this article is cited
Right arrow Citation Map
Services
Right arrow Email this article
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new content in the JCB
Right arrow Download to citation manager
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via CrossRef
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Li, H.
Right arrow Articles by Lilien, J.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Li, H.
Right arrow Articles by Lilien, J.
Related Collections
Right arrowRelated Article
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Facebook   Add to Reddit   Add to Technorati   Add to Twitter  
What's this?


  Home | Help | Feedback | Subscriptions | Archive | Search | Table of Contents