|
||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
© The Rockefeller University Press,
0021-9525/2000//1275 $5.00
The Journal of Cell Biology, Volume 149, Number 6,
, 2000 1275-1288
Original Article |
Coordinate Regulation of Cadherin and Integrin Function by the Chondroitin Sulfate Proteoglycan Neurocan
jlilien{at}biology.biosci.wayne.edu
N-cadherin and β1-integrins play decisive roles in morphogenesis and neurite extension and are often present on the same cell. Therefore, the function of these two types of adhesion systems must be coordinated in time and space to achieve the appropriate cell and tissue organization. We now show that interaction of the chondroitin sulfate proteoglycan neurocan with its GalNAcPTase receptor coordinately inhibits both N-cadherin– and β1-integrin–mediated adhesion and neurite outgrowth. Furthermore, the inhibitory activity is localized to an NH2-terminal fragment of neurocan containing an Ig loop and an HA-binding domain. The effect of neurocan on β1-integrin function is dependent on a signal originating from the cadherin cytoplasmic domain, possibly mediated by the nonreceptor protein tyrosine kinase Fer, indicating that cadherin and integrin engage in direct cross-talk. In the developing chick, neural retina neurocan is present in the inner plexiform layer from day 7 on, and the GalNAcPTase receptor becomes restricted to the inner nuclear layer and the ganglion cell layer (as well as the fiber layer), the two forming a sandwich. These data suggest that the coordinate inhibition of cadherin and integrin function on interaction of neurocan with its receptor may prevent cell and neurite migration across boundaries.
Key Words: cadherin integrin adhesion neurite outgrowth tyrosine kinase Fer
© 2000 The Rockefeller University Press
| Introduction |
|---|
|
|
|---|
β1-Integrins and N-cadherin have long been recognized as two transmembrane adhesion receptors critical to neurite outgrowth (Bixby et al. 1988; Neugebauer et al. 1988; Tomaselli et al. 1989). We have previously suggested that a cell-surface glycosyltransferase (GalNAcPTase) may be a critical component of one regulatory circuit that coordinates the activity of these two adhesion systems (Gaya-Gonzalez et al. 1991; Lilien et al. 1997, Lilien et al. 1999). The GalNAcPTase is anchored to the plasma membrane by a glycophosphatidylinositide linkage (Balsamo and Lilien 1993), and specifically associates with N- and E-cadherin (Balsamo and Lilien 1990; Bauer et al. 1992) but not β1-integrins (Lilien et al. 1999). Binding of one unique mAb to the GalNAcPTase initiates a signal that results in coordinate inhibition of N-cadherin and β1-integrin–mediated neurite outgrowth (Gaya-Gonzalez et al. 1991). We hypothesized that the activity of this antibody reflected the activity of an endogenous ligand. Indeed, we subsequently identified and purified a 250-kD chondroitin sulfate proteoglycan (250kD PG) that binds to the same, or an overlapping, domain of the GalNAcPTase. It also initiates a signal that results in retention of the phosphate on tyrosine residues of β-catenin and uncoupling of cadherin from its association with actin, with concomitant inhibition of N-cadherin–mediated adhesion and neurite outgrowth (Balsamo et al. 1995, Balsamo et al. 1996).
To further study the molecular mechanism of the interaction between 250kD PG and its receptor, GalNAcPTase, we have isolated the complete cDNA coding for the 250kD PG and show that binding of the protein backbone to the GalNAcPTase initiates a signal cascade that results in coordinate inhibition of cadherin- and integrin-mediated adhesion and neurite outgrowth. Sequence analysis shows that the 250kD PG is the chicken homologue of neurocan. Chicken neurocan contains the conserved NH2- and COOH-terminal protein motifs characteristic of the aggrecan/versican/neurocan/brevican family of chondroitin sulfate proteoglycans (Ruoslahti 1996; Schwartz et al. 1999). The conserved motifs are
70% similar to rat neurocan, but there is little sequence similarity (<10%) in the central region, where the majority of the consensus sites for attachment of chondroitin sulfate side chains occur. The coordinate regulation of cadherin and integrin function is due to a direct interaction between the NH2 terminus of neurocan containing the Ig loop and hyaluronic acid (HA-binding) domain and the GalNAcPTase, as removal of the GalNAcPTase with PI-PLC abrogates the coordinate regulatory activity. Furthermore, coordinate regulation appears to be due to a signal originating from the cytoplasmic domain of cadherin directly affecting integrin function. Our results suggest a mechanism whereby neurite outgrowth may be directionally controlled by environmental cues defining axonal trajectories.
| Materials and Methods |
|---|
|
|
|---|
Isolation of the cDNA Encoding Neurocan
Total RNA was purified from day 10 embryonic chicken brain (E10) and retina using an RNeasy kit (Qiagen). RNA was reverse transcribed into first-strand cDNA using a degenerate primer based on the amino acid sequence of the most highly conserved region of the HA-binding domain present in all members of the hyaluronic acid binding family of proteins, CDAGWL: 5'-A(GA)CCAICCIGC(AG)TC(AG)CA-3' (Rauch et al. 1992). PCR was performed using two sets of nonoverlapping primers derived from microsequencing of the NH2 terminus and a cyanogen bromide fragment of the 250 kD PG core protein. Inosine (I) was used to reduce degeneracy.
The NH2-terminal amino acid sequence with the two nested primers underlined are as follows: DQDEGKVIHISRVQHQAVRVGLGEPVALP, 5'-GGIAA(AG)GTIATICA(CT)ATI(AT(GC)I(AC)GIGTICA-3'; and 5'-GTIGGI(TC)TIGGIGA(AG)CCIGTIGCI(TC)TICC-3'. The internal sequence with two nested primers underlined are as follows: DNSAVIASPQHLQ... and ...QAAFEDGYDN, 5'-TT(AG)TC(AG)-TAICC(AG)TC(TC)TC(AG)AAIGCIGC(TC)TG-3'; and 5'-TGIA-(AG)(AG)TG(TC)TGIGGI(GC)(AT)IGCIATIACIGC-3'.
A 450-bp product was obtained, subcloned into the TA vector (Invitrogen Corp.) and sequenced. This sequence showed 71% similarity to rat and mouse neurocan. The PCR product was radiolabeled and used as a probe to screen a chick brain
-Zap cDNA library. Eight positive clones were isolated and cloned into pBluescript SK (Stratagene). Restriction pattern analysis revealed two distinct clones with inserts of 1.8 and 2.0 kb, with 1.5 kb of overlap yielding 2.3 kb of unique sequence. To obtain the full-length cDNA sequence, reverse transcriptase-inverse-PCR was used (Zeiner and Gehring 1994). In brief, first-strand cDNA was made from E10 chick brain total RNA using an oligo-dT primer, followed by second-strand cDNA synthesis and blunt-end circularization of the double-stranded cDNA. The circularized cDNA was used as a template for a set of nested primers based on the 5' and 3' ends of the 2.3 kb of known sequence pointing away from the known sequence, allowing amplification of regions flanking the 2.3-kb fragment. A complete clone was constructed by recombinant PCR using the high fidelity polymerase, elongase (GIBCO BRL) and sequenced (sequence data available from GenBank/EMBL/DDBJ under accession number AF116856).
Northern Blot Analysis
Total RNA was isolated from E10 chick brains using the RNeasy kit (Qiagen). 5 µg of total RNA was separated on 1% denaturing agarose gel, transferred to Hybond-N+ membrane (Amersham), and hybridized with a probe of 1.1 kb from the central region of the cDNA sequence. This probe was used as it is the least conserved region of the full-length clone. After high stringency washes, (0.1x SSPE, 0.1% SDS) the membrane was exposed to Biomax X-film (Eastman Kodak Co.).
Preparation of Recombinant His-tagged Bacterial Fusion Protein
The complete open reading frame lacking the signal peptide (nucleotides 128–4467), with adaptor sequences, was obtained by PCR, digested with NdeI and BglII, and ligated into pET-15b (Novagen, Inc.), which was predigested with the same enzymes. Fusion protein fragments representing the NH2- and COOH-terminal domains were generated as follows (see Fig. 2). An NH2-terminal fragment was generated by cutting the full-length construct with NdeI and partially with XhoI, ligating the released DNA fragment containing nucleotides 128–1400 into the pET-15b vector that was predigested with the same enzymes. A COOH-terminal fragment was generated by cutting the full-length construct with BamHI and the released DNA fragment, containing nucleotides 2668–4467, was ligated into BamHI-linearized pET-15b vector. The NH2-terminal construct was further cut with XhoI to generate an Ig (nucleotides 128–518) and an HA (nucleotides 518–1400) fragment. A second Ig fragment containing a piece of HA-binding region was generated by PCR using the 5' primer used to clone the complete open reading frame and a 3' primer corresponding to nucleotides 599–622. All fragments were also ligated into pET-15b at appropriate restriction sites and confirmed by sequencing. The constructs were transformed into BL21(DE) (Novagen, Inc.), and induced bacteria were pelleted and stored at –80°C until needed. Fusion proteins were extracted from the cell pellet in buffer containing 6 M urea, purified on Ni2+ columns following the manufacturer's recommendations (Novagen, Inc.), and renatured by a series of dialyses in PBS with 0.1 mM DTT. The final products were aliquoted and frozen at –80°C.
|
Interaction of Neurocan with the Cell-surface GalNAcPTase
E9 retina cells, prepared by trypsinization in the presence of Ca2+ as described above, were incubated with neurocan fusion peptides (
20 x 106 cells/100 µl of HBSGKCa containing
0.2 mM fusion peptide or BSA) for 1 h at 4°C. Cells were pelleted, resuspended in 0.25 mM DTSSP cross-linker (Pierce Chemical Co.) in PBS, and incubated at 4°C for 30 min. The cells were again pelleted, washed in HBSGKCa, and lysed in homogenization buffer (1% Triton X-100, 20 mM Tris, pH 7.5, 150 mM NaCl, 1:1,000 AESBF [Sigma Chemical Co.], 100 µg/ml DNase, 2 mM o-vanadate, 1 mM NaF) at 4°C for 30 min. The lysates were centrifuged at 14,000 g for 5 min, and the supernatant was mixed with an equal volume of Immunomix (1% Triton X-100, 0.5% DOC, 1% SDS, 0.1% BSA in 25 mM Tris, pH 7.9, 150 mM NaCl, 1 mM PMSF). The solution was cleared by centrifugation and incubated with monoclonal anti-GalNAcPTase antibody for 2 h at 4°C. The precipitates were collected using goat anti–mouse IgM attached to magnetic beads, washed in Immunomix, and fractionated by SDS-PAGE. Western transfers were probed with polyclonal antineurocan antibody or HRP nickel (KPL) as previously described (Balsamo et al. 1995). As controls, peptides were added to cells immediately after treatment with the cross-linking reagent.
Association of N-Cadherin with the Actin Cytoskeleton
Coprecipitation of N-cadherin and actin was carried out as previously described (Balsamo et al. 1991) with minor modifications. 105 E9 chick retina cells (see above) were preincubated with or without neurocan peptides for 5 or 15 min on ice, in a total volume of 0.5 ml, followed by 5 min at 37°C and 120 rpm. The cells were pelleted and lysed on ice in 1 ml of homogenization buffer for 30 min. The lysates were centrifuged at 14,000 g for 5 min, and the supernatants were incubated with anti–N-cadherin antibody NCD-2 (5 µg/ml) under constant rotation at 4°C for 4 h. The samples were incubated for an additional 1 h with goat anti–rat IgG-conjugated magnetic beads (PerSeptive Biosystems), washed four times in homogenization buffer, boiled in 50 µl of SDS sample buffer for 5 min, fractionated by SDS-PAGE, and Western transfers were probed with antiactin antibody and the anti–N-cadherin antibody NCD-2 as described previously (Balsamo et al. 1995).
Tyrosine Phosphorylation of β-Catenin
Cells were treated as above for coprecipitation of actin and N-cadherin, with the exception that all cell homogenates were made 1% in SDS to disrupt protein–protein interactions. The cell lysate was diluted to 0.1% SDS with homogenization buffer, and immunoprecipitated with anti–β-catenin antiserum (1:100). The immunoprecipitates were fractionated by SDS-PAGE and Western transfers were probed with antiphosphotyrosine antibody (PY 20; Transduction Laboratories), followed by HRP-conjugated goat anti–mouse IgG. The membranes were stripped and reprobed with anti–β-catenin antibody (Transduction Laboratories) and developed with alkaline phosphatase–conjugated goat anti–rabbit IgG (Jackson ImmunoResearch Laboratories, Inc.).
Cell Permeable Peptides
Peptides containing the cell permeable sequence derived from the antennapedia homeodomain (Perez et al. 1992; Derossi et al. 1994; Prochiantz 1996) and sequences from the N-cadherin cytoplasmic domain (Arregui et al. 2000) were synthesized and purified to >90% by HPLC (Genemed Biotechnologies, Inc.). All peptides were dissolved in sterile deionized water, stored in small aliquots at –70°C, and used at 2 µM, a concentration that gives maximal inhibition without toxicity (Arregui et al. 2000). The three peptides used are as follows: COP, RQIKIWFQNRRMKWKK (antennapedia sequence alone); CBP, RQIKIWFQNRRMKWKKSLLVFDYEGSGSTAGSLSSL (antennapedia plus the β-catenin binding region); and JMP, RQIKIWFQNRRMKWKKRQAKQLLIDPEDDVRDNILK (antennapedia plus the juxtamembrane region).
Immunohistochemistry
Chicken eyes from embryos at different ages were carefully dissected in cold PBS, and fixed in freshly made 4% paraformaldehyde at 4°C overnight. Fixed eyes were washed three times in PBS (10–15 min each), and the neural retina and pigmented retina layers were removed and maintained in 30% sucrose in PBS overnight at 4°C and frozen in Histoprep medium (Fisher Scientific) at –80°C. 20-µm sections were cut at –25°C, picked up on gelatin-coated coverslips, air-dried on a 37°C hot plate, and frozen at –20°C. Before staining, the sections were heated to 60°C on a hot plate, rehydrated, and washed three times with PBS. After blocking with 3% goat serum in PBS for 2 h at room temperature, the sections were incubated with the appropriate primary antibody in 3% goat serum in PBS at room temperature for 1 h. After washing three times with PBS, the sections were incubated with secondary antibody in 3% goat serum in PBS at room temperature for 1 h, followed by another three washes with PBS. Finally, the sections were mounted on slides with Vectashield (Vector Laboratories, Inc.) antifading mounting medium, sealed with nail polish, and analyzed as for neurite outgrowth.
Single cells were prepared and plated on laminin-coated coverslips as described above for neurite outgrowth assays at a density of 100,000 cells/coverslip. The cells were cultured overnight, and fixed in 4% paraformaldehyde for 20 min at room temperature. For immunostaining, cells were treated similarly to tissue sections, except that 0.4% saponin was included in the incubation buffer when cell permeabilization was required. Tissue sections and cells were observed under phase and epifluorescence using a Zeiss universal microscope. Images were captured and analyzed as for neurite outgrowth.
| Results |
|---|
|
|
|---|
70% sequence identity between chicken and rat, whereas the central region shows little similarity, <10%.
|
Northern analysis with total RNA from E10 chicken brain reveals a single band of
5.4 kb (not shown). This is significantly smaller than the rat or human mRNA (Rauch et al. 1992; Prange et al. 1998). Given the conserved size of the coding region, this discrepancy in message size is most likely because of the differences in the 3' and/or 5' noncoding regions.
To determine whether the cloned cDNA represented the 250kD PG, recombinant neurocan produced in bacteria was reacted with anti-250kD PG antibody (Fig. 3). Neurocan is recognized by affinity-purified anti-250kD PG antibody. Additional bands recognized by the anti-250kD antibody are most likely degradation products. The recombinant polypeptide has a calculated molecular mass of 141.6 kD, however, the apparent molecular mass on SDS-PAGE is >200 kD. This discrepancy in migration rate was also seen when recombinant rat neurocan was fractionated by SDS-PAGE. This has been attributed to the stiff, rodlike structure of the central region of the molecule (Retzler et al. 1996b).
|
|
To further characterize the inhibitory effect of recombinant neurocan and its fragments, we assayed their effect on N–cadherin-mediated neurite outgrowth by E7 retina cells. The results are in agreement with those for adhesion. The NH2-terminal fragment of neurocan, but not the COOH-terminal fragment inhibits neurite extension (Fig. 5A and Fig. B). As for adhesion, inhibition of neurite outgrowth by the anticadherin antibody NCD-2 as well as the anti-GalNAcPTase mAb 1B1 indicate that neurite outgrowth is mediated by N-cadherin. Importantly, neurite outgrowth on poly-L-lysine is unaffected by neurocan (not shown). Thus, it is specifically the function of cadherin (or integrin, see below) that is affected, not other aspects of the machinery required for neurite outgrowth.
|
60% (Fig. 6). This residual adhesion may be a result of nonspecific interactions or the function of nonintegrin laminin receptors (Powell and Kleinman 1997). Like JG22, the NH2-terminal fragment inhibits adhesion to laminin by
60% at 10 µg/ml, whereas the COOH-terminal fragment has little or no effect (Fig. 6). This suggests that the NH2-terminal fragment inhibits β1-integrin–mediated adhesion by close to 100%. β1-Integrin–mediated neurite outgrowth is similarly affected; the NH2-terminal, but not the COOH-terminal fragment, inhibits neurite extension (Fig. 7 A) with maximal inhibition by the NH2-terminal fragment of
60% at 10 µg/ml (Fig. 7 B). In agreement with our previous observations (Gaya-Gonzalez et al. 1991), the anti-GalNAcPTase antibody 1B11 inhibits neurite extension on laminin. Thus, interaction of the NH2-terminal fragment of neurocan with cells results in coordinate inhibition of cadherin- and integrin-mediated adhesion and neurite outgrowth.
|
|
|
|
|
In the companion paper (Arregui et al. 2000), we have used cell permeable peptides coupled to sequences mimicking specific regions of the cytoplasmic domain of N-cadherin to cause the release of effectors from the cadherin complex, and have assayed their effect on N-cadherin and β1-integrin–mediated adhesion. Consistent with the above hypothesis, a cell permeable peptide bearing a sequence mimicking the juxtamembrane region of N-cadherin (JMP) causes the specific release of the nonreceptor tyrosine kinase Fer, normally associated with the cadherin complex of cytoplasmic proteins (Kim and Wong 1995; Rosato et al. 1998), and its translocation to the cytoplasmic complex of proteins associated with β1-integrin with concomitant loss of β1-integrin–mediated adhesion (Arregui et al. 2000). In contrast, treatment of cells with a cell permeable peptide containing a sequence that mimics the β-catenin binding region of N-cadherin (CBP) also causes the release of Fer, but in a complex with β-catenin and p120CAT. Under these circumstances Fer is not translocated to the integrin complex and there is no effect on integrin function (Arregui et al. 2000).
To determine if treatment of cells with recombinant neurocan NH2-terminal fragment also results in translocation of Fer from cadherin to the β1-integrin complex, retina cells were treated with recombinant NH2-terminal neurocan, cell lysates immunoprecipitated with anti–N-cadherin antibody or anti-FAK antibody, and the immunoprecipitates were analyzed for the presence of Fer. Indeed, Fer is lost from the cadherin complex and appears associated with the integrin complex (Fig. 11). Like neurocan, treatment of cells with the anti-GalNAcPTase antibody 1B11, but not 7A2, also results in the loss of N-cadherin and β1-integrin functions and translocation of Fer to the integrin complex (Fig. 11). If translocation of Fer from cadherin to integrin, on treatment of cells with neurocan, is causally related to the loss of integrin function, we speculated that the release of Fer complexed with p120CAT and β-catenin, as occurs when cells are treated with CBP, might eliminate this signal, abolishing the effect of neurocan on integrin-mediated adhesion. To test this idea, we pretreated retina cells for 2 h with CBP, before addition of neurocan. Pretreatment with CBP does in fact abolish the effect of neurocan on β1-integrin–mediated adhesion (Fig. 12). Treatment with the CBP alone or control antennapedia peptide (COP) alone has no effect on integrin-mediated adhesion (Fig. 12). Thus, a specific configuration of proteins associated with the cytoplasmic domain of N-cadherin is essential for neurocan-mediated inhibition of integrin function. Furthermore, translocation of the nonreceptor protein tyrosine kinase Fer from cadherin to integrin appears to be at least one component of a mechanism required for signaling from cadherin to integrin (Arregui et al. 2000).
|
|
|
|
|
| Discussion |
|---|
|
|
|---|
In Fig. 16, we have attempted to pictorially represent the interactions taking place on binding of neurocan to its GalNAcPTase receptor. Loss of cadherin function is correlated with uncoupling from the cytoskeleton after hyperphosphorylation and release of β-catenin from its association with cadherin (Balsamo et al. 1995). Hyperphosphorylation of β-catenin has consistently been correlated with the loss of adhesive function (Daniel and Reynolds 1997; Lilien et al. 1997). Our laboratory has demonstrated that the nonreceptor protein tyrosine phosphatase PTP1B regulates β-catenin phosphorylation (Balsamo et al. 1995, Balsamo et al. 1996, Balsamo et al. 1998). PTP1B binds to the cytoplasmic domain of N-cadherin and is essential for the continued removal of phosphate from tyrosine residues of β-catenin (Balsamo et al. 1998). Furthermore, phosphorylation of PTP1B is essential for binding to cadherin (Balsamo et al. 1996, Balsamo et al. 1998). Neurocan–GalNAcPTase interaction results in inactivation or loss of protein tyrosine kinase activity from the cadherin complex. This appears to initiate a cascade resulting in the loss of PTP1B, retention of phosphate groups on tyrosine residues of β-catenin and uncoupling of cadherin from the actin cytoskeleton (Balsamo et al. 1995, Balsamo et al. 1996, Balsamo et al. 1998). Based on the data presented in this paper and Arregui et al. 2000, the protein tyrosine kinase may be the nonreceptor tyrosine kinase Fer. Disassembly of the cadherin complex of proteins and the cytoskeletal connection on interaction of neurocan with its receptor may also be accompanied by loss of cadherin dimers, which is the functional unit required for strong adhesion (Yap et al. 1997; Takeda et al. 1999).
|
Loss of integrin function, either through overexpression of Fer (Rosato et al. 1998) or through perturbation with a cell permeable peptide mimicking the juxtamembrane region of cadherin (Arregui et al. 2000) is correlated with hypophosphorylation of p130cas, as is the inability to assemble focal adhesions (Nojima et al. 1995; Petch et al. 1995; Vuori and Ruoslahti 1995). p130cas interacts directly with the tyrosine phosphatases PTP-PEST (Garton et al. 1997) and PTP1B (Liu et al. 1996), as well as the tyrosine kinase FAK (Polte and Hanks 1995). It has been suggested that these components compete with each other to regulate the tyrosine phosphorylation of p130cas and, therefore, assembly of focal adhesions (Garton et al. 1997). Tyrosine-phosphorylated p130cas also interacts with Crk (Matsuda and Kurata 1996), and this interaction has the potential to protect p130cas from dephosphorylation (Birge et al. 1992). The most conservative explanation for the hypophosphorylation of p130cas on interaction of Fer with the integrin complex is that Fer affects one or more of p130cas' binding partners, PTP-PEST, PTP1B, FAK or even Crk, altering their activity, or their interaction with p130cas, changing the balance of phosphorylated tyrosine residues and, thus, integrin function.
Neurocan's Modular Organization Allows Interactions with Many Adhesion-related Molecules
Neurocan is a member of a family of structurally similar chondroitin sulfate proteoglycans (Margolis and Margolis 1994) including aggrecan (Doege et al. 1987), versican (Zimmermann and Ruoslahti 1989), and brevican (Yamada et al. 1994; Jaworski et al. 1995). The family has been referred to as lecticans (Ruoslahti 1996) or hyalectans (Iozzo 1998). All members of the family have a similar modular organization, a conserved Ig-loop and hyaluronic acid (HA)–binding motifs at the NH2 terminus, and EGF-like, lectin-like and complement regulatory-like domains on the COOH terminus. The structure of this family appears as two globular domains separated by a linear domain containing the majority of the chondroitin sulfate chains (Retzler et al. 1996b).
Sequence comparisons of neurocan from rat (Rauch et al. 1992), mouse (Rauch et al. 1995), human (Prange et al. 1998), and now chicken, reveal that these NH2- and COOH-terminal domains are highly conserved (Fig. 1 A). However, the central elongate region shows little or no conservation. These data suggest that each of the NH2- and COOH-terminal domains has specific functions, while the functional role(s) of the central portion requires only conservation of minimal sequence motifs essential for glycosylation.
Both the sugar side chains and the polypeptide backbone of neurocan interact with adhesion-related molecules. NCAM and NgCAM interact with neurocan through the chondroitin sulfate chains (Friedlander et al. 1994) and both intact neurocan and neurocan-C, a naturally occurring COOH-terminal fragment with a 150-kD core protein (Oohira et al. 1994), are able to inhibit homophilic binding of NCAM (Retzler et al. 1996a). Additionally, neurocan inhibits neurite extension by neurons that express NCAM and NgCAM, presumably by interacting directly with these cell adhesion molecules to disrupt homophilic interactions (Grumet et al. 1993, Grumet et al. 1996; Friedlander et al. 1994). In contrast, the Ig superfamily adhesion molecule TAG-1/axonin-1 interacts with the neurocan core protein (Milev et al. 1996). The physiological significance of these interactions is supported by the overlapping distribution of these adhesion molecules with neurocan in embryonic and early postnatal nervous tissue (Milev et al. 1996).
The COOH terminus of the neurocan polypeptide interacts with the extracellular matrix protein tenascin-C (Rauch 1997). The COOH-terminal lectinlike domain of brevican binds cell-surface glycolipids and promotes cell adhesion (Miura et al. 1999), suggesting a similar function for the neurocan lectinlike domain. Additionally, the COOH terminus of several family members can bind simple sugars (Halberg et al. 1988; Saleque et al. 1993; Ujita et al. 1994), suggesting lectin-like interactions.
Our data add to the group of adhesion-related molecules that interact with neurocan and further indicate a specific role for the NH2 terminus containing the Ig loop and the HA-binding domain in regulating cadherin and integrin function. The predominant expression of neurocan in the central nervous system (Oohira et al. 1994; Meyer-Puttlitz et al. 1995; Fukuda et al. 1997; Matsui et al. 1998) and its multiple interactions through distinct domains with adhesion-related molecules suggests that neurocan has evolved as an modular extracellular regulator of cell–cell and cell–matrix interactions that guide the cellular rearrangements essential to the formation and function of the nervous system.
Neurocan May Act as a Barrier to Neurite Extension in the Developing Retina
In the developing retina, neurocan expression predominates in the IPL, but is also transiently associated with the outer plexiform layer (OPL), whereas the GalNAcPTase, which was originally distributed to most layers in the retina, becomes restricted to the ganglion cell layer and inner nuclear layer, sandwiching the IPL. Consistent with this distribution, we find that, in vitro, it is amacrine cells with multiple processes that express and synthesize neurocan and deposit it on the substrate around cell bodies and processes.
There are two possible exceptions to this cellular distribution. First, we occasionally observe that neurocan and the amacrine cell marker HPC-1 do not overlap. This may be explained by the number of different subtypes of amacrine cells, some expressing neurocan and others not, but all being HPC-1–positive. Alternatively, HPC-1 also weakly reacts with some horizontal cells (Gleason et al. 1993), and it is possible that, in our culture system, some HPC-1–positive cells are horizontal cells, not expressing neurocan. We do observe transient neurocan staining in the OPL at around day 14, and this may be due to transient expression by horizontal cells. Second, some neurocan-positive cells with typical stellate morphology are positive for the ganglion cell marker, 8D9. It is likely that these cells are not ganglion cells. In fact, it has been shown that 8D9 does stain the IPL faintly. This may be due to either ganglion cell dendrites or processes of amacrine cells (Lemmon and McLoon 1986). Our finding that amacrine cells express neurocan favors the latter possibility; however, we cannot exclude the possibility that some ganglion cells may also express neurocan.
The ability of neurocan to affect the function of many distinct adhesion molecules either directly or indirectly suggests that its spatiotemporal distribution may play critical roles in morphogenesis of the retina. While much is known about the distribution of adhesion molecules in the developing retina and some functional analyses have been performed using antibodies (Buskirk et al. 1980; Hoffman et al. 1986; Matsununga et al. 1988; Svennevik and Linser 1993; Stone and Sakaguchi 1996) and by introducing dominant negative constructs into the developing Xenopus eye (Lilienbaum et al. 1995; Riehl et al. 1996), the role of endogenous modifiers of adhesion molecule function, such as neurocan, has not been explored experimentally. Chondroitin sulfate proteoglycans have been shown to act as a barrier to neurite extension in general (Faissner and Steindler 1995; Margolis and Margolis 1997) and have been suggested to influence the direction of retinal ganglion cell outgrowth (Snow et al. 1991). The expression of neurocan juxtaposed by its receptor, GalNAcPTase, does indeed suggest a role for this interacting pair in restricting cell or process movement mediated by cadherin and/or integrin at such boundaries. Furthermore, because of its interactions with other adhesion molecules in the immunoglobulin superfamily, neurocan is well suited to such a role in the retina. Thus neurocan, and possibly other chondroitin sulfate proteoglycans, may act to prevent ganglion cell projections from extending to other layers of the retina, orienting them to form the nerve fiber layer. Indeed, retinal neurons extend processes in vitro mediated by cadherin, integrin and NCAM (Neugebauer et al. 1988), and purified neurocan acts as barrier to neurite extension by retina neurons in vitro (Balsamo et al. 1996).
| Acknowledgments |
|---|
Submitted: 10 February 2000
Revised: 11 April 2000
Accepted: 4 May 2000
The present address of H. Li is Neuroscience Center, Nelson Biological Laboratories, 604 Allison Road, Rutgers University, Piscataway, NJ 08854-8082. The present address of T.C. Leung is Department of Developmental Biology, Institute Biology I, University of Freiburg, Hauptstrasse 1, D-79104 Freiburg, Germany. The present address of J. Balsamo and J. Lilien is Department of Biological Sciences, University of Iowa, Iowa City, IA 52242-1324.
| References |
|---|
|
|
|---|
Arregui C., Balsamo J. & Lilien J.. Impaired integrin-mediated adhesion and signaling in fibroblasts expressing a dominant negative mutant PTP1B, J. Cell Biol., 143, 1999, 861–873.[Medline]
Arregui C., Pathre P., Lilien J. & Balsamo J.. The nonreceptor tyrosine kinase Fer mediates cross-talk between N-cadherin and β1-integrin, J. Cell Biol., 149, 2000, 1263–1273.
Balsamo J. & Lilien J.. N-cadherin is stably associated with, and is an acceptor for, a cell surface N-acetylgalactosaminylphosphotransferase, J. Biol. Chem., 265, 1990, 2923–2928.
Balsamo J. & Lilien J.. The retina cell-surface N-acetylgalactosaminylphosphotransferase is anchored by a glycophosphatidylinositol, Biochemistry., 32, 1993, 8246–8250.[Medline]
Balsamo J., Hoffman S. & Lilien J.. Control of cadherin-mediated cell-cell adhesion through regulated association with the cytoskeleton, J. Braz. Assoc. Adv. Sci., 48, 1996, 341–346.
Balsamo J., Pratt R.S., Emmerling M.R., Grunwald G. & Lilien J.. Identification of the chick neural retina cell surface N-acetylgalactosaminyltransferase using monoclonal antibodies, J. Cell Biochem., 32, 1986, 125–141.[Medline]
Balsamo J., Thiboldeaux R., Swaminathan N. & Lilien J.. Antibodies to the retina N-acetylgalactosaminylphosphotransferase modulate N-cadherin–mediated adhesion and uncouple the N-cadherin transferase complex from the actin-containing cytoskeleton, J. Cell Biol., 113, 1991, 429–436.
Balsamo J., Ernst H., Zanin M.K., Hoffman S. & Lilien J.. The interaction of the retina cell surface N-acetylgalactosaminylphosphotransferase with an endogenous proteoglycan ligand results in inhibition of cadherin-mediated adhesion, J. Cell Biol., 129, 1995, 1391–1401.
Balsamo J., Leung T.-C., Ernst H., Zanin M.K., Hoffman S. & Lilien J.. Regulated binding of a PTP1B-like phosphatase to N-cadherincontrol of cadherin-mediated adhesion by dephosphorylation of β-catenin, J. Cell Biol., 134, 1996, 801–813.
Balsamo J., Arregui C., Leung T.-C. & Lilien J.. The nonreceptor protein tyrosine phosphatase PTP1B binds to the cytoplasmic domain of N-cadherin and regulates the cadherin-actin linkage, J. Cell Biol., 143, 1998, 523–532.
Barnstable C.J., Hofstein R. & Akagawa K.. A marker for early amacrine cell developement in rat retina, Brain Res., 325, 1985, 286–290.[Medline]
Bauer G.E., Balsamo J. & Lilien J.. Cadherin-mediated adhesion in pancreatic islet cells is modulated by a cell surface N-acetylgalactosaminylphosphotransferase, J. Cell. Sci., 103, 1992, 1235–1241.
Bause E.. Structural requirements of N-glycosylation of proteins. Studies with proline peptides as conformational probes, Biochem. J., 209, 1983, 331–336.[Medline]
Birge B., Fagardo J., Mayer B. & Hanafusa H.. Tyrosine phosphorylated epidermal growth factor receptor and p130 provide high affinity binding substrates to analyze Crk-phosphotyrosine-dependent interactions in vitro, J. Biol. Chem., 267, 1992, 10588–10595.
Bixby J.L., Lilien J. & Reichardt L.F.. Identification of the major proteins that promote neuronal process outgrowth on Schwann cells in vitro, J. Cell Biol., 107, 1988, 355–361.
Bourdon M.A., Krusius T., Campbell S., Schwartz N.B. & Ruoslahti E.. Identification and synthesis of a recognition signal for the attachment of glycosaminoglycans to proteins, Proc. Natl. Acad. Sci. USA., 84, 1987, 3194–3198.
Buj-Bello A., Adu J., Pinon L.G.P., Horton A., Thompson J., Rosenthal A., Chinchetru M., Buchman V.L. & Davis A.M.. Neurturin responsiveness requires a GPI-linked receptor and the Ret receptor tyrosine kinase, Nature., 387, 1997, 721–724.[Medline]
Burden-Gulley S.M. & Brady-Kalnay S.M.. PTPµ regulates N-cadherin–dependent neurite outgrowth, J. Cell Biol., 144, 1999, 1323–1336.
Buskirk D.R., Thiery J.P., Rutishauser U. & Edelman G.M.. Antibodies to neural cell adhesion molecule disrupt histogenesis in cultured chick retinae, Nature., 285, 1980, 488–489.[Medline]
Daniel J.M. & Reynolds A.B.. Tyrosine phosphorylation and cadherin/catenin function, Bioessays., 19, 1997, 883–891.[Medline]
Derossi D., Joliot A.H., Chassaing G. & Prochiantz A.. The third helix of the antennapedia homeodomain translocates through biological membranes, J. Biol. Chem., 269, 1994, 10444–10450.
Doege K., Sasaki M., Horigan E., Hassell J.R. & Yamada Y.. Complete primary structure of the rat cartilage proteoglycan core protein deduced from cDNA clones, J. Biol. Chem., 262, 1987, 17757–17767.
Faissner A. & Steindler D.. Boundaries and inhibitory molecules in developing neural tissues, Glia., 13, 1995, 233–254.[Medline]
Friedlander D.R., Milev P., Karthikeyan L., Margolis R.K., Margolis R.U. & Grumet M.. The neuronal chondroitin sulfate proteoglycan neurocan binds to the neural cell adhesion molecules Ng-CAM/L1/NILE and N-CAM, and inhibits neuronal adhesion and neurite outgrowth, J. Cell Biol., 125, 1994, 669–680.
Fukuda T., Kawano H., Ohyama K., Li H.P., Takeda Y., Oohira A. & Kawamura K.. Immunohistochemical localization of neurocan and L1 in the formation of thalamocortical pathway of developing rats, J. Comp. Neurol., 382, 1997, 141–152.[Medline]
Garton A.J., Burnbaum M.R., Bouton A.H. & Tonks N.K.. Association of PTP-PEST with the SH3 domain of p130casa novel mechanism of protein tyrosine phosphatase substrate recognition, Oncogene., 15, 1997, 877–885.[Medline]
Gaya-Gonzalez L., Balsamo J., Swaminathan N. & Lilien J.. Antibodies to the retina N-acetylgalactosaminylphosphotransferase inhibit neurite outgrowth, J. Neurosci. Res., 29, 1991, 474–480.[Medline]
Gleason E., Borges S. & Wilson M.. Synaptic transmission between pairs of retinal amacrine cells in culture, J. Neurosci., 13, 1993, 2359–2370.[Abstract]
Goodman C.S. & Tessier-Lavigne M.. Molecular mechanisms of axon guidance and target recognition, Cowan W.M., Jessel T.M. & Zipursky S.L., Molecular and Cellular Approaches to Neural Development, 1997, 108–178, Oxford University Press, New York.
Greve J.M. & Gottlieb D.I.. Monoclonal antibodies which alter the morphology of cultured chick myogenic cells, J. Cell. Biochem., 18, 1982, 221–229.[Medline]
Grumet M., Flaccus A. & Margolis R.U.. Functional characterization of chondroitin sulfate proteoglycans of braininteractions with neurons and neural cell adhesion molecules, J. Cell Biol., 120, 1993, 815–824.
Grumet M., Friedlander D.R. & Sakurai T.. Functions of brain chondroitin sulfate proteoglycans during developmentinteractions with adhesion molecules, Perspect. Dev. Neurobiol., 3, 1996, 319–330.[Medline]
Halberg D.F., Proulx G., Doege K., Yamada Y. & Drickamer K.. A segment of the cartilage proteoglycan core protein has lectin-like activity, J. Biol. Chem., 263, 1988, 9486–9490.
Hatta K. & Takeichi M.. Expression of N-cadherin adhesion molecules associated with early morphogenetic events in chick development, Nature., 320, 1986, 447–449.[Medline]
Hoffman S., Friedlander D.R., Chuong C.-M., Grumet M. & Edelman G.M.. Differential contributions of Ng-CAM and N-CAM to cell adhesion in different neural regions, J. Cell Biol., 103, 1986, 145–158.
Iozzo R.V.. Matrix proteoglycansfrom molecular design to cellular function, Annu. Rev. Biochem., 67, 1998, 609–652.[Medline]
Iwamoto T., Taniguchi N., Asai N., Ohkusin K., Nakashima I. & Takahashi M.. cDNA cloning of mouse ret proto-oncogene and its sequence similarity to the cadherin superfamily, Oncogene., 8, 1993, 1087–1091.[Medline]
Jing S., Wen D., Yu Y., Holst P.L., Luo Y., Fang M., Tamir R., Antonio L., Hu Z. & Cupples R.. GDNF-induced activation of the ret protein tyrosine kinase is mediated by GDNFR-
, a novel receptor for GDNF, Cell., 85, 1996, 1113–1124.[Medline]
Jaworski D.M., Kelly G.M. & Hockfield S.. BEHAB, a member of the proteoglycan tandem repeat family of hyaluronan-binding proteins that is restricted to the brain, J. Cell Biol., 125, 1995, 495–509.[Medline]
Kim L. & Wong T.W.. The cytoplasmic tyrosine kinase FER is associated with the catenin-like substrate pp120 and is activated by growth factors, Mol. Cell. Biol., 15, 1995, 4553–4561.[Abstract]
Klein R.D., Sherman D., Ho W.-H., Stone D., Bennett G.L., Moffat B., Vandlen R., Simmons L., Gu Q. & Hongo J.-A.. A GPI-linked protein that interacts with Ret to form a candidate neurturin receptor, Nature., 387, 1997, 717–721.[Medline]
Kreuger R.C. Jr., Fields T.A., Hildreth J. IV & Schwartz N.B.. Chick cartilage chondroitin sulfate proteoglycan core protein I. Generation and characterization of peptides and specificity for glycosaminoglycan attachment, J. Biol. Chem., 265, 1990, 12075–12087.
Lemmon V.. Monoclonal antibodies specific for glia in the chick nervous system, Brain Res., 355, 1985, 111–120.[Medline]
Lemmon V. & McLoon S.C.. The appearance of an L1-like molecule in the chick visual pathway, J. Neurosci., 6, 1986, 2987–2994.[Abstract]
Lilien J., Balsamo J., Hoffman S. & Eisenberg C.. β-Catenin is a target for extracellular signals controlling cadherin functionthe neurocan-GalNAcPTase connection, Curr. Top. Dev. Biol., 35, 1997, 161–189.[Medline]
Lilien J., Arregui C., Li H. & Balsamo J.. The juxtamembrane domain of cadherin regulates integrin-mediated adhesion and neurite outgrowth, J. Neurosci. Res., 58, 1999, 727–734.[Medline]
Lilienbaum A., Reszka A.A., Horwitz A.F. & Holt C.E.. Chimeric integrins expressed in retinal ganglion cells impairs process outgrowth in vivo, Mol. Cell. Neurosci., 6, 1995, 139–152.[Medline]
Liu F., Hill D.E. & Chernoff J.. Direct binding of the proline-rich region pf protein tyrosine phosphatase 1B to the Src homology 3 domain of p130cas, J. Biol. Chem., 271, 1996, 31290–31295.
Margolis R.U. & Margolis R.K.. Aggrecan-versican-neurocan family proteoglycans, Methods Enzymol., 245, 1994, 105–126.[Medline]
Margolis R.U. & Margolis R.K.. Chondroitin sulfate proteoglycans as mediators of axon growth and pathfinding, Cell Tissue Res., 290, 1997, 343–348.[Medline]
Matsuda M. & Kurata T.. Emerging components of the Crk oncogene productthe first identified adaptor protein, Cell Signal., 8, 1996, 335–340.[Medline]
Matsui F., Nishizuka M., Yasuda Y., Aono S., Watanabe E. & Oohira A.. Occurrence of a N-terminal proteolytic fragment of neurocan, not a C-terminal half, in a perineuronal net in the adult rat cerebrum, Brain Res., 790, 1998, 45–51.[Medline]
Matsununga M., Hatta K. & Takeichi M.. Role of N-cadherin cell adhesion molecules in the histogenesis of neural retina, Neuron., 1, 1988, 289–295.[Medline]
Meyer-Puttlitz B., Milev P., Junker E., Zimmer I., Margolis R.U. & Margolis R.K.. Chondroitin sulfate and chondroitin/keratan sulfate proteoglycans of nervous tissuedevelopmental changes of neurocan and phosphocan, J. Neurochem., 65, 1995, 2327–2337.[Medline]
Milev P., Maurel P., Haring M., Margolis R.K. & Margolis R.U.. TAG-1/axonin-1 is a high-affinity ligand of neurocan, phosphocan/protein-tyrosine phosphatase-zeta/beta, and N-CAM, J. Biol. Chem., 271, 1996, 15716–15723.
Miura R., Aspberg A., Ethell I.M., Hagihara K., Schnaar R.L., Ruoslahti E. & Yamaguchi Y.. The proteoglycan lectin domain binds sulfated cell surface glycolipids and promotes cell adhesion, J. Biol. Chem., 274, 1999, 11431–11438.
Mueller B.K.. Growth cone guidancefirst steps towards a deeper understanding, Annu. Rev. Neurosci., 22, 1999, 351–388.[Medline]
Neugebauer K.M., Tomaselli K.J., Lilien J. & Reichardt L.R.. N-cadherin, NCAM, and integrins promote retinal neurite outgrowth on astrocytes in vitro, J. Cell Biol., 107, 1988, 1177–1187.
Nojima Y., Morino N., Mimura T., Hamasaki K., Furuya H., Sakai R., Sato T., Tachibana K., Morimoto C., Yazaki Y. & Hirai H.. Integrin-mediated cell adhesion promotes tyrosine phosphorylation of p130cas, a Src-homology 3-containing molecule having multiple Src homology 2-binding motifs, J. Biol. Chem., 270, 1995, 15398–15402.
Oohira A., Matsui F., Watanabe E., Kushima Y. & Maeda N.. Developmentally regulated expression of a brain specific species of chondroitin sulfate proteoglycan, neurocan, identified with a monoclonal antibody IG2 in the rat cerebrum, Neuroscience., 60, 1994, 145–157.[Medline]
Perez F., Joliot A., Bloch-Gallego E., Zahroui A., Triller A. & Prochiantz A.. Antennapedia homeobox as a signal for the cellular internalization and nuclear addressing of a small exogenous peptide, J. Cell. Sci., 102, 1992, 717–722.
Petch L.A., Bockholt S.M., Bouton A., Parsons J.T. & Burridge K.. Adhesion induced tyrosine phosphorylation of the p130 src substrate, J. Cell. Sci., 108, 1995, 1371–1379.[Abstract]
Polte T.R. & Hanks S.K.. Interaction between focal adhesion kinase and Crk-associated tyrosine kinase substrate p130cas, Proc. Natl. Acad. Sci. USA., 92, 1995, 10678–10682.
Powell S.K. & Kleinman H.K.. Neuronal laminins and their cellular receptors, Int. J. Biochem. Cell Biol., 29, 1997, 401–414.[Medline]
Prange C.K., Pennacchio L.A., Lieuallen K., Fan W. & Lennon G.G.. Characterization of the human neurocan gene, CSPG3, Gene., 221, 1998, 199–205.[Medline]
Prochiantz A.. Getting hydrophilic compounds into cellslessons from homeopeptides, Curr. Opin. Neurobiol., 6, 1996, 629–634.[Medline]
Rauch U.. Modeling an extracellular environment for axonal pathfinding and fasciculation in the central nervous system, Cell Tissue Res., 290, 1997, 349–356.[Medline]
Rauch U., Karthikeyan L., Maurel P., Margolis R.U. & Margolis R.K.. Cloning and primary structure of neurocan, a developmentally regulated, aggregating chondroitin sulfate proteoglycan of brain, J. Biol. Chem., 267, 1992, 19536–19547.
Rauch U., Grimpe B., Kulbe G., Arnold-Ammer I., Beier D.R. & Fassler R.. Structure and chromosomal localization of the mouse neurocan gene, Genomics., 28, 1995, 405–410.[Medline]
Retzler C., Gohring W. & Rauch U.. Analysis of neurocan structures interacting with the neural cell adhesion molecule N-CAM, J. Biol. Chem., 271, 1996, 27304–27310a.
Retzler C., Wiedemann H., Kulbe G. & Rauch U.. Structural and electron microscopic analysis of neurocan and recombinant neurocan fragments, J. Biol. Chem., 271, 1996, 17107–17113b.
Riehl R., Johnson K., Bradley R., Grunwald G.B., Cornel E., Lilienbaum A. & Holt C.E.. Cadherin function is required for axon outgrowth in retinal ganglion cells in vivo, Neuron., 17, 1996, 837–848.[Medline]
Rosato R., Veltmaat J.M., Groffen J. & Heistrekamp N.. Involvement of the tyrosine kinase Fer in cell adhesion, Mol. Cell. Biol., 18, 1998, 5762–5770.
Ruoslahti E.. Brain extracellular matrix, Glycobiology., 6, 1996, 489–492.
Saleque S., Ruiz N. & Drickamer K.. Expression and characterization of a carbohydrate-binding fragment of rat aggrecan, Glycobiology., 3, 1993, 185–210.
Schwartz N.B., Pirok E.W. III, Mensch J.R. Jr. & Domowicz M.S.. Domain organization, genomic structure, evolution, and regulation of expression of the aggrecan gene family, Prog. Nucleic Acid Res. Mol. Biol., 62, 1999, 177–225.[Medline]
Scott L.J., Balsamo J., Sanes J.R. & Lilien J.. Synaptic localization and neural regulation of an N-acetylgalactosaminyltransferase in skeletal muscle, J. Neurosci., 10, 1990, 346–350.[Abstract]
Snow D.M., Watanabe W., Letourneau P.C. & Silver J.. A chondroitin sulfate proteoglycan may influence the direction of retinal ganglion cell outgrowth, Development., 113, 1991, 1473–1485.[Abstract]
Song H.-J. & Poo M.-M.. Signal transduction underlying growth cone guidance by diffusible factors, Curr. Opin. Neurobiol., 9, 1999, 355–363.[Medline]
Stone K.E. & Sakaguchi D.S.. Perturbation of the developing Xenopus retinotectal projection following injections of antibodies against β1-integrin receptors and N-cadherin, Develop. Biol., 180, 1996, 297–310.[Medline]
Svennevik E. & Linser P.J.. The inhibitory effects of integrin antibodies and the RGD tripeptide on early eye development, Invest. Ophth. Vis. Sci., 34, 1993, 1774–1784.
Takeda H., Shimoyama Y., Nagafuchi A. & Hirohashi S.. E-cadherin functions as a cis-dimer at the cell-cell adhesive interface in vivo, Nat. Struct. Biol., 6, 1999, 310–312.[Medline]
Tomaselli K.J., Reichardt L.F. & Bixby J.L.. Distinct molecular interactions mediate process outgrowth on nonneuronal cell surfaces and extracellular matrices, J. Cell Biol., 106, 1986, 2659–2672.[Medline]
Tomaselli K.J., Neugebauer K.M., Bixby J.L., Lilien J. & Reichardt L.F.. N-cadherin and integrinstwo receptor systems that mediate neuronal process outgrowth on astrocyte surfaces, Neuron., 1, 1989, 33–43.
Treanor J.J.S., Goodman L., de Sauvage F., Stone D.M., Poulsen K.T., Beck C.D., Gray C., Armanini M.P., Pollock R.A. & Hefti F.. Characterization of a multicomponent receptor for GDNF, Nature., 382, 1996, 80–83.[Medline]
Ujita M., Shinomura T., Ito K., Kitagawa Y. & Kimata K.. Expression and binding activity of the carboxyl-terminal portion of the core protein of PG-M, a large chondroitin sulfate proteoglycan, J. Biol. Chem., 269, 1994, 27603–27609.
Vuori K. & Ruoslahti E.. Tyrosine phosphorylation of p130cas and cortactin accompanies integrin-mediated cell adhesion to extracellular matrix, J. Biol. Chem., 270, 1995, 22257–22262.
Yamada H., Watanabe K., Shimonaka M. & Yamaguchi Y.. Molecular cloning of brevican, a novel brain proteoglycan of the aggrecan/versican family, J. Biol. Chem., 269, 1994, 10119–10126.
Yap A.S., Brieher W.M., Pruschy M. & Gumbiner B.M.. Lateral clustering of the adhesive ectodomaina fundamental determinant of cadherin function, Curr. Biol., 7, 1997, 308–315.[Medline]
Zanin M.K.B., Bundy J., Ernst H., Wessels A., Conway J.S. & Hoffman S.. Distinct spatial and temporal distributions of aggrecan and versican in the embryonic chick heart, Anat. Rec., 256, 1999, 366–380.[Medline]
Zeiner M. & Gehring U.. Cloning of 5' cDNA regions by inverse PCR, Biotechnology., 17, 1994, 1050–1052.
Zimmermann D.R. & Ruoslahti E.. Multiple domains of the large fibroblast proteoglycan, versican, EMBO. (Eur. Mol. Biol. Organ.) J., 8, 1989, 2975–2981.[Medline]
Related Article
This article has been cited by other articles:
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|