|
||
Article |
Stimulation of transit-peptide release and ATP hydrolysis by a cochaperone during protein import into chloroplasts
Correspondence to Hsou-min Li: mbhmli{at}gate.sinica.edu.tw
|
|
|---|
Three components of the chloroplast protein translocon, Tic110, Hsp93 (ClpC), and Tic40, have been shown to be important for protein translocation across the inner envelope membrane into the stroma. We show the molecular interactions among these three components that facilitate processing and translocation of precursor proteins. Transit-peptide binding by Tic110 recruits Tic40 binding to Tic110, which in turn causes the release of transit peptides from Tic110, freeing the transit peptides for processing. The Tic40 C-terminal domain, which is homologous to the C terminus of cochaperones Sti1p/Hop and Hip but with no known function, stimulates adenosine triphosphate hydrolysis by Hsp93. Hsp93 dissociates from Tic40 in the presence of adenosine diphosphate, suggesting that Tic40 functions as an adenosine triphosphatase activation protein for Hsp93. Our data suggest that chloroplasts have evolved the Tic40 cochaperone to increase the efficiency of precursor processing and translocation.
M.-L. Chou's present address is Department and Institute of Life Science, Tzu-Chi University, Hualien 97004, Taiwan.
Abbreviations used in this paper: AMP-PNP, adenylylimidodiphosphate; Hip, Hsp70-interacting protein; Hop, Hsp70/Hsp90-organizing protein; prFD, precursor to ferrodoxin; prRBCS, precursor to the small subunit of ribulose-1,5-bisphosphate carboxylase oxygenase; Tic, translocon at the inner envelope membrane of chloroplasts; Toc, translocon at the outer envelope membrane of chloroplasts; TPR, tetratricopeptide repeat.
| Introduction |
|---|
|
|
|---|
Tic110 is the major Tic protein identified (Kessler and Blobel, 1996; Lübeck et al., 1996). Tic110 has an N-terminal membrane anchor and a large stroma-located hydrophilic domain (Jackson et al., 1998; Inaba et al., 2003). The N-terminal half of the Tic110 stromal domain binds transit peptides directly. Tic110 is therefore thought to be the stroma-side receptor for transit peptides and the first protein that binds precursors as they emerge from the inner membrane channel (Inaba et al., 2003, 2005). Hsp93 (ClpC) belongs to the Clp/Hsp100 subfamily of the AAA+ (ATPase associated with various cellular activities) family of proteins (Schirmer et al., 1996; Hanson and Whiteheart, 2005). It is present both in a soluble form in the stroma and in an inner membranetethered form (Nielsen et al., 1997; Kouranov et al., 1998). It is proposed to function as the motor for chloroplast protein translocation, as translocation requires ATP hydrolysis in the stroma (Theg et al., 1989) and Hsp93 is the only known ATPase stably associated with the entire translocon complex (Nielsen et al., 1997).
Tic40 has a similar topology to Tic110. The stroma-located hydrophilic domain of Tic40 is composed of a tetratricopeptide repeat (TPR) domain followed by a C-terminal domain homologous to the C terminus of cochaperones Sti1p/Hop (Hsp70/Hsp90-organizing protein) and Hip (Hsp70-interacting protein; Frydman and Höhfeld, 1997; Chou et al., 2003). TPR domains, which consist of highly degenerated 34-amino-acid repeats, are present in proteins of diverse functions and are known to mediate proteinprotein interactions (Höhfeld et al., 1995; Lamb et al., 1995; Scheufler et al., 2000). In contrast, no molecular function had been assigned to the Hip and Hop C-terminal domain, even though this domain is highly conserved from yeast (Sti1p) to human (Hip and Hop) to plants (Tic40).
Tic40 has been shown to function at a similar stage of import to Tic110 and Hsp93 (Chou et al., 2003; Kovacheva et al., 2005). Arabidopsis thaliana tic40-null mutants are extremely pale green and retarded in development but still viable, suggesting that Tic40 plays a nonessential stimulatory/regulatory role during import. Chloroplasts isolated from tic40 mutants are normal in binding of precursors to the outer envelope membrane but are specifically defective in precursor translocation across the inner envelope membrane. Precursors tend to be released from tic40 mutant chloroplasts before the completion of translocation. Based on these results, we have proposed that Tic40 may function as a cochaperone to coordinate the action of Tic110 and Hsp93 (Chou et al., 2003). This hypothesis predicts that the Tic40 will physically interact with Tic110 and/or Hsp93 and the interaction will have regulatory or mechanical consequence to the import of precursor proteins into the stroma. In this work, we have analyzed the molecular interactions among Tic40, Tic110, and Hsp93. We provide evidence to show that Tic40 regulates transit peptideTic110 interaction and Hsp93 ATP hydrolysis.
| Results |
|---|
|
|
|---|
|
|
|
|
|
When the total membranes after import were further solubilized for immunoprecipitation, anti-Tic110 antibodies immunoprecipitated a high amount of mature RBCS in the wild-type chloroplasts (Fig. 5 B, bottom). Before immunoprecipitation, the ratio of RBCS to prRBCS was 12:1 at the 30-min import time point, and when precipitated by anti-Tic110 antibodies, the ratio increased to 29:1 (Fig. 5 C). This result indicated that there was a population of RBCS that was specifically associated with Tic110 and Tic110-associated translocon complexes. This population was likely absent in tic40 because in the mutant chloroplasts the ratio of RBCS to prRBCS remained similar in total membranes and in the population precipitated by anti-Tic110 antibodies (Fig. 5 C). It is possible that in the tic40 mutant chloroplasts, by the time transit peptides are spontaneously released by Tic110, the mature region of the precursor proteins has been translocated further into the stroma.
The Hip/Hop domain of Tic40 stimulates Hsp93 ATP hydrolysis
Because Hsp93 is the only chaperone molecule stably associated with the entire translocon complex, its ATPase activity should be important for precursor translocation. We therefore investigated which component that may have contact with Hsp93 could affect its ATPase activity. Recombinant pea Hsp93 with an N-terminal His6 tag, His6-Hsp93 (Fig. 1), was assayed for its ability to hydrolyze ATP. Addition of prFD transit peptides, Tic110, or Tic40 all had an approximately twofold stimulation on Hsp93 ATP hydrolysis compared with Hsp93 alone (Fig. 6 A).
It is not clear whether such a small stimulation was specific or merely due to the presence of unfolded proteins. We further analyzed the effect of Tic40 subdomains. GST-atTic40TPR or -atTic40Hip/Hop was incubated with Hsp93. Interestingly, it was the Tic40 Hip/Hop domain, not the TPR domain, that had a clear stimulatory effect on Hsp93 ATP hydrolysis (Fig. 6 A). Various combinations of atTic110S-His6 plus domains of Tic40 or prFD transit peptides were also tested, and no additional stimulatory effect was observed (unpublished data). In support of the importance of the Tic40 Hip/Hop domain, A. thaliana tic40 mutant plants could be complemented by a full-length cDNA encoding the Tic40 precursor, but not by the same construct with the Hip/Hop domain deleted (unpublished data).
|
The tic40 mutant is extremely pale and small but still viable (Chou et al., 2003), indicating that Tic40 plays a nonessential stimulatory/regulatory role during import. If Tic40 functions in stimulating Hsp93 ATP hydrolysis in vivo, either by promoting ATP/ADP exchange or by activating Hsp93 ATPase activity, it is likely that the protein import defect of tic40 mutants can be partially compensated by increasing the available amount of ATP in the stroma. We therefore preloaded isolated wild-type and tic40 mutant chloroplasts with 3 mM ATP and performed import experiments. Without ATP preloading, the amount of mature RBCS imported by the tic40 mutant chloroplasts was 26% of the wild-type chloroplasts. With ATP preloading, the tic40 mutant was increased to 38% of wild type (Fig. 7 A).
We further confirmed the physiological significance of the results by testing whether Hsp93 ATPase activity was different in the two ATP concentrations before and after ATP preloading. Dark-adapted chloroplasts at the beginning of import have a stromal ATP concentration of
0.07 mM (Robinson and Portis, 1988; Theg et al., 1989; see Materials and methods). Preincubating chloroplasts in 3 mM ATP for 5 min at room temperature should increase the stromal ATP concentration to
2.1 mM (Leheny and Theg, 1994). The ATPase activity of Hsp93 was indeed increased significantly from an ATP concentration of 0.07 to 2.1 mM (Fig. 7 B). Stimulation of Hsp93 ATP hydrolysis by Tic40 provides another possible explanation for the release of untranslocated precursors from the tic40 mutant chloroplasts: a rapid ATP hydrolysis by Hsp93, stimulated by Tic40, may be important for a unidirectional translocation of precursors into the stroma.
|
| Discussion |
|---|
|
|
|---|
A working model for the sequential steps of protein translocation into the chloroplast stroma is proposed here (Fig. 8): as the transit peptide of a precursor protein emerges from the inner envelope membrane channel, it is bound by the N-terminal part of the Tic110 stromal domain (Fig. 8 A). This binding causes a conformational change in Tic110 and recruits Tic40TPR binding to Tic110 (Fig. 8 B). Binding of Tic40TPR to Tic110 causes release of the transit peptide from Tic110, freeing the transit peptide for cleavage by the stromal processing peptidase. Binding of Tic40TPR to Tic110 also unshields the Tic40 Hip/Hop domain, which then stimulates ATP hydrolysis by Hsp93 (Fig. 8 C). The energy of ATP hydrolysis by Hsp93 is most likely used to translocate the processed mature protein into the stroma (Fig. 8 D). Analyses of similar AAA+ proteins suggest that these proteins actively push substrates through its axial channel using conformational changes caused by ATP hydrolysis (Wang et al., 2001; Hanson and Whiteheart, 2005; Hinnerwisch et al., 2005). Hsp93-ADP may then dissociate from Tic40 (Fig. 8 D). Tic110 may also dissociate from Tic40 when there is no transit peptide bound. Under normal growth conditions in the light in which the stromal ATP concentration is high, Hsp93 may soon be reloaded with ATP and be ready for the next round of precursor translocation after Tic110 binds another incoming transit peptide. In our model, ATP is hydrolyzed only after the Tic40 TPR domain binds to Tic110, which only occurs after Tic110 binds to transit peptides. Therefore, Tic40 may function like a timing device to coordinate the sequential steps of translocation.
|
A possible similarity between protein translocation into the chloroplast stroma and retrotranslocation of misfolded proteins from the ER lumen is noted here. ER retrotranslocation requires the cytosolic ATPase p97/Cdc48, which is an AAA+ family protein, like Hsp93. VIMP (VCP interacting membrane protein), an ER-membrane protein with a sizeable cytosolic domain, acts as a receptor for p97, similar to Tic110 (Jackson et al., 1998). VIMP links p97 to Derlin-1, which is a proposed component of the ER retrotranslocation channel (Lilley and Ploegh, 2004; Ye et al., 2004). Derlin-1 is
25 kD with four predicted
-helical transmembrane domains, a size and structure very similar to Tic20, the proposed protein translocation channel across the chloroplast inner envelope membrane (Kouranov et al., 1998). Therefore, both systems contain an AAA+ type motor, a membrane protein with a large soluble domain as the receptor for the motor and a channel of a similar size and structure. It is possible that the substrates of both systems, the chloroplast precursors after being translocated across the outer membrane and the misfolded ER proteins after being recruited to Derlin-1, are in a similar folding state. Tic40 may have been evolved to meet some specific requirements of chloroplasts to increase the efficiency of precursor processing and translocation.
| Materials and methods |
|---|
|
|
|---|
Two-hybrid assays were performed using the MatchMaker-II system (CLONTECH Laboratories, Inc.) according to the manufacturer's instructions. Except where specified in the figure legends, pull-down assays using His6-tagged proteins were performed using TALON (CLONTECH Laboratories, Inc.) resin by incubating the resin with the protein mixture at 4°C for 2 h. Pelleted resin was washed thrice with PBS (10 mM Na2HPO4, 1.8 mM KH2PO4, 140 mM NaCl, and 2.7 mM KCl) containing 1 mM imidazole, and bound proteins were eluted with 50 mM imidazole in 50 mM Tris-HCl, pH 8.0. Pull-down assays using GST-tagged proteins were performed using Glutatione-4B resin (GE Healthcare) by incubating the resin with the protein mixture at 4°C for 30 min to 1 h. Pelleted resin was washed thrice with PBS, and bound proteins were eluted with 10 mM glutathione in 50 mM Tris-HCl, pH 8.0.
Recombinant prRBCS and RBCS were overexpressed and purified from E. coli (Tu et al., 2004). Antibodies against Tic110 were generated as described previously (Tu et al., 2004). Antibodies against Tic40 were produced by subcloning the coding region of atTic40 residues 227447 into pET22b (Invitrogen), overexpressing the recombinant protein with a C-terminal His6 tag in E. coli, and injecting the purified recombinant proteins into mice. Anti-Hsp93 and anti-OE33 antibodies were generated by immunizing rabbits with the His6-Hsp93 and OE33-His6 recombinant proteins described in the previous paragraph.
Peptides and peptide labeling
The first 34 amino acids of the Silene prFD transit peptide without the initiation methionine (sequence ASTLSTLSVSASLLPKQQPMVASSLPTNMGQALF; Pilon et al., 1995) and the SynB2 peptide (sequence MLSRQQSQRQSRQQSQRQSRYLL; Allison and Schatz, 1986) were synthesized and purified by HPLC to >80% purity by SynPep. 1.5 mg of the prFD peptide was dissolved in 50 µl of water and mixed with 20 µl of boric acid (adjusted to pH 8.5 with NaOH), 20 µl of 0.5 M formaldehyde, and 15 µl of 3H-labeled 0.12 M NaBH4. The reaction was incubated on ice for 15 min and quenched by adding 50 µl of 1 M Tris-HCl, pH 7.5. 3H-labeled peptide and 3H-labeled NaBH4 were separated on a Sephadex G-10 column with 0.1 M NH4HCO3. The peptide fractions were collected and dried.
Protein import into isolated chloroplasts
[35S]prRBCS and [35S]RBCS were synthesized by in vitro transcription and translation (Perry et al., 1991). Growth of A. thaliana plants, isolation of chloroplasts from the WS2 wild type and the tic40-1 mutant, import assays and isolation, solubilization, and immunoprecipitation of membrane fraction from chloroplasts after import were performed as described previously (Chou et al., 2003). Stromal ATP concentrations used in Fig. 7 B is calculated as follows: internal ATP concentration of dark-adapted chloroplasts is
1.82 nmol/mg chlorophyll (Robinson and Portis, 1988; Theg et al., 1989). With a stroma volume of 25 µl/mg chlorophyll (Robinson, 1985), 1.82 nmol/mg chlorophyll is
0.07 mM. At room temperature for 5 min, ATP translocation across the envelope can achieve
70% (Leheny and Theg, 1994). Preincubating chloroplasts in 3 mM ATP for 5 min at room temperature should increase the stromal ATP concentration to
2.1 mM. Quantifications of gel images were performed on LAS-1000plus pictrography 3000 (Fuji).
Hsp93 ATPase assay
A 16-µl solution containing 0.5 µM of His6-Hsp93 in 75 mM Hepes-KOH, pH 7.0, and 4 mM MgCl2 was mixed with 4 µl of 1 mM ATP containing 0.078 µl of
-[32P]ATP (5,000 Ci/nmol) and incubated at 37°C for 30 min. The reaction was stopped by adding 2 µl of 0.5 M EDTA. 0.35 µl of the reaction was spotted on a TLC plate. The plate was air-dried, and ATP and Pi were separated by a solution containing 0.5 M LiCl and 1 M formic acid. The TLC plate was dried. The amounts of ATP and Pi were quantified by a PhosphorImager (FLA-5000; Fuji). When other proteins were added to the reaction, they were present at the same concentration as His6-Hsp93, except for the prFD transit peptide, which was present at a 10x concentration of other proteins.
| Acknowledgments |
|---|
H.-m. Li was supported by grants from National Science Council (NSC95-2321-B-001-004) and Academia Sinica of Taiwan. M. Akita acknowledges financial support during early parts of the work from U.S. Department of Energy and U.S. National Science Foundation grants to Dr. Ken Keegstra (Michigan State University).
Submitted: 28 September 2006
Accepted: 15 November 2006
| References |
|---|
|
|
|---|
Allison, D., and G. Schatz. 1986. Artificial mitochondrial presequences. Proc. Natl. Acad. Sci. USA. 83:90119015.
Chen, K.-Y., and H.-m. Li. 2006. Precursor binding to an 880-kD Toc complex as an early step during active protein import into chloroplasts. Plant J. In press.
Chou, M.-L., L.M. Fitzpatrick, S.-L. Tu, G. Budziszewski, S. Potter-Lewis, M. Akita, J.Z. Levin, K. Keegstra, and H.-m. Li. 2003. Tic40, a membrane-anchored co-chaperone homologue in the chloroplast protein translocon. EMBO J. 22:29702980.[CrossRef][Medline]
Frydman, J., and J. Höhfeld. 1997. Chaperones get in touch: the Hip-Hop connection. Trends Biochem. Sci. 22:8792.[CrossRef][Medline]
Hanson, P., and S. Whiteheart. 2005. AAA+ proteins: have engine, will work. Nat. Rev. Mol. Cell Biol. 6:519529.[CrossRef][Medline]
Hinnah, S.C., R. Wagner, N. Sveshnikova, R. Harrer, and J. Soll. 2002. The chloroplast protein import channel Toc75: pore properties and interaction with transit peptides. Biophys. J. 83:899911.
Hinnerwisch, J., W. Fenton, K. Furtak, G. Farr, and A. Horwich. 2005. Loops in the central channel of ClpA chaperone mediate protein binding, unfolding, and translocation. Cell. 121:10291041.[CrossRef][Medline]
Höhfeld, J., Y. Minami, and F.U. Hartl. 1995. Hip, a novel cochaperone involved in the eukaryotic Hsc70/Hsp40 reaction cycle. Cell. 83:589598.[CrossRef][Medline]
Inaba, T., M. Li, M. Alvarez-Huerta, F. Kessler, and D.J. Schnell. 2003. atTic110 functions as a scaffold for coordinating the stromal events of protein import into chloroplasts. J. Biol. Chem. 278:3861738627.
Inaba, T., M. Alvarez-Huerta, M. Li, J. Bauer, C. Ewers, F. Kessler, and D.J. Schnell. 2005. atTic110 is essential for the assembly and function of the protein import machinery of plastids. Plant Cell. 17:14821496.
Jackson, D.T., J.E. Froehlich, and K. Keegstra. 1998. The hydrophilic domain of Tic110, an inner envelope membrane component of the chloroplastic protein translocation apparatus, faces the stromal compartment. J. Biol. Chem. 273:1658316588.
Kessler, F., and G. Blobel. 1996. Interaction of the protein import and folding machineries in the chloroplast. Proc. Natl. Acad. Sci. USA. 93:76847689.
Kessler, F., and D.J. Schnell. 2006. The function and diversity of plastid protein import pathways: a multilane GTPase highway into plastids. Traffic. 7:248257.[CrossRef][Medline]
Kouranov, A., X. Chen, B. Fuks, and D.J. Schnell. 1998. Tic20 and Tic22 are new components of the protein import apparatus at the chloroplast inner envelope membrane. J. Cell Biol. 143:9911002.
Kovacheva, S., J. Bedard, R. Patel, P. Dudley, D. Twell, G.D. Rios, C. Koncz, and P. Jarvis. 2005. In vivo studies of the roles of Tic110, Tic40 and Hsp93 during chloroplast protein import. Plant J. 41:412428.[Medline]
Lamb, J., S. Tugendreich, and P. Hieter. 1995. Tetratrico peptide repeat interactions: to TPR or not to TPR? Trends Biochem. Sci. 20:257259.[CrossRef][Medline]
Leheny, E.A., and S.M. Theg. 1994. Apparent inhibition of chloroplast protein import by cold temperatures is due to energetic considerations not membrane fluidity. Plant Cell. 6:427437.[Abstract]
Lilley, B.N, and H.L. Ploegh. 2004. A membrane protein required for dislocation of misfolded proteins from the ER. Nature. 429:834840.[CrossRef][Medline]
Lübeck, J., J. Soll, M. Akita, E. Nielsen, and K. Keegstra. 1996. Topology of IEP110, a component of the chloroplastic protein import machinery present in the inner envelope membrane. EMBO J. 15:42304238.[Medline]
Nielsen, E., M. Akita, J. Davila-Aponte, and K. Keegstra. 1997. Stable association of chloroplastic precursors with protein translocation complexes that contain proteins from both envelope membranes and a stromal Hsp100 molecular chaperone. EMBO J. 16:935946.[CrossRef][Medline]
Perry, S.E., H.-m. Li, and K. Keegstra. 1991. In vitro reconstitution of protein transport into chloroplasts. Methods Cell Biol. 34:327344.[Medline]
Pilon, M., H. Wienk, W. Sips, M. de Swaaf, I. Talboom, R. van't Hof, G. de Korte-Kool, R. Demel, P. Weisbeek, and B. de Kruijff. 1995. Functional domains of the ferredoxin transit sequence involved in chloroplast import. J. Biol. Chem. 270:38823893.
Prapapanich, V., S. Chen, and D.F. Smith. 1998. Mutation of Hip's carboxy-terminal region inhibits a transitional stage of progesterone receptor assembly. Mol. Cell. Biol. 18:944952.
Richter, S., and G. Lamppa. 1998. A chloroplast processing enzyme functions as the general stromal processing peptidase. Proc. Natl. Acad. Sci. USA. 95:74637468.
Robinson, S. 1985. The involvement of stromal ATP in maintaining the pH gradient across the chloroplast envelope in the light. Biochim. Biophys. Acta. 806:187194.[CrossRef]
Robinson, S., and A.J. Portis. 1988. Involvement of stromal ATP in the light activation of ribulose-1,5-bisphosphate carboxylase/oxygenase in intact isolated chloroplasts. Plant Physiol. 86:293298.
Scheufler, C., A. Brinker, G. Bourenkov, S. Pegpraro, L. Morder, H. Bartunik, F. Hartl, and I. Moarefi. 2000. Structure of TPR domain-peptide complexes: critical elements in the assembly of the Hsp70-Hsp90 multichaperone machine. Cell. 101:199210.[CrossRef][Medline]
Schirmer, E., J. Glover, M. Singer, and S. Lindquist. 1996. Hsp100/Clp proteins: a common mechanism explains diverse functions. Trends Biochem. Sci. 21:289296.[CrossRef][Medline]
Schnell, D.J., F. Kessler, and G. Blobel. 1994. Isolation of components of the chloroplast protein import machinery. Science. 266:10071012.
Soll, J., and E. Schleiff. 2004. Protein import into chloroplasts. Nat. Rev. Mol. Cell Biol. 5:198208.[CrossRef][Medline]
Theg, S.M., C. Bauerle, L.J. Olsen, B.R. Selman, and K. Keegstra. 1989. Internal ATP is the only energy requirement for the translocation of precursor proteins across chloroplastic membranes. J. Biol. Chem. 264:67306736.
Tu, S.-L., L.-J. Chen, M. Smith, Y.-s. Su, D. Schnell, and H.-m. Li. 2004. Import pathways of chloroplast interior proteins and the outer-membrane protein OEP14 converge at Toc75. Plant Cell. 16:20782088.
Wang, J., J.J. Song, I.S. Seong, M.C. Franklin, S. Kamtekar, S.H. Eom, and C.H. Chung. 2001. Nucleotide-dependent conformational changes in a protease-associated ATPase HslU. Structure. 9:11071116.[Medline]
Yang, J., S.M. Roe, M. Cliff, M. Williams, J. Ladbury, P. Cohen, and D. Barford. 2005. Molecular basis for TPR domain-mediated regulation of protein phosphatase 5. EMBO J. 24:110.[CrossRef][Medline]
Ye, Y., Y. Shibata, C. Yun, D. Ron, and T.A. Rapoport. 2004. A membrane protein complex mediates retro-translocation from the ER lumen into the cytosol. Nature. 429:841847.[CrossRef][Medline]
This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|