Table 1

TRAP and Its Putative Paralog and Orthologs in Apicomplexan Parasites

Protein
ParasiteNameEC domainCytoplasmic tail
GenusStageA-DOMTSR
PlasmodiumSporozoiteTRAP11YNFIAGSSAAAMAGAAPF**VMA***KGIVNQFKLP**NWN
OokineteCTRP67YNTLNGGTPHNSNMFNVNNGII***N**FVIANPMWN
ToxoplasmaTachyzoiteMIC215YHYYLSSSVGSPSAIYA**GATKVVM***KTLVPV***SMWME
EimeriaSporozoiteEtp10015YGLSGGSAAAATAGAVMTAGTSNAAVKSLISAGQSMWAS
CryptosporidiumSporozoiteTRAPC15LFLIGGRSGQ****TNYQYFQSSATLQSYVQIGPSQNWAS